DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and IRC24

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_012302.3 Gene:IRC24 / 854854 SGDID:S000001475 Length:263 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:58/216 - (26%)
Similarity:97/216 - (44%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQVVWITGASSGIGRALALSLARHGVKLVL--SARRLEQLEQVQEECLAAARGLLATKDVLVIQ- 107
            |:|:.|||||.|||..|..::.....:.::  .||....|:.:|.|..|         |..|.: 
Yeast     2 GKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGA---------DKFVYRV 57

  Fly   108 MDMLDLDEHKTHLNTVLNHFHRLDVLVNNAG-----RSQRASWTEVEIEVDRELFELDVFAVVHL 167
            :|:.|....:..:..:.....:||.:|.|||     :|...|.:|.:|:....||:::.|::|.|
Yeast    58 LDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSL 122

  Fly   168 SRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVE--MRKLDVSLFA 230
            ..|.:. .::.:...|:|...||.|...|......|..:|.|||.:.:.:..|  ..|:.....|
Yeast   123 VALCLP-LLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIA 186

  Fly   231 PGPIATDF---LQEAFTGSQG 248
            ||.:.|..   ::|.. |.||
Yeast   187 PGVVDTQMQKDIRETL-GPQG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 58/216 (27%)
adh_short 47..245 CDD:278532 54/210 (26%)
IRC24NP_012302.3 SPR-like_SDR_c 4..255 CDD:187625 57/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.