DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and YDL114W

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:50/213 - (23%)
Similarity:91/213 - (42%) Gaps:36/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 ITGASSGIGRALALSLARHGVKLVLS-ARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLD 114
            |||.|||:|..||..|:|...|:::: .:......||:            ..::...|.|:..||
Yeast    43 ITGGSSGLGFELAKELSRRINKVIVADIQSFPTFAQVE------------YNNIFYYQCDITSLD 95

  Fly   115 EHKTHLNTVLNHFHRLDVLVNNAGRS---QRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFV 176
            |.|.....:......:::::||||.:   :....|..|:|   :|.::::.....    ::..|.
Yeast    96 EIKNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEVE---QLIDINLIGAYR----IISTFA 153

  Fly   177 EQ--NGGRGHIAATSSIAG-FSPVPFSPTYCAAKHA-------LNAYLLSLKVEMRKLDVS--LF 229
            |.  :...|.|...:|:.| .:|...: :|.|:|.|       ::.:..||..|..|..:.  |.
Yeast   154 EDMIDNREGFIINIASVLGELTPARLT-SYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLLV 217

  Fly   230 APGPIATDFLQEAFTGSQ 247
            .||.|.|:...:..|.|:
Yeast   218 CPGKIKTNMFIDVPTPSK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 50/213 (23%)
adh_short 47..245 CDD:278532 48/209 (23%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 50/213 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.