DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and HSD4

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_199871.1 Gene:HSD4 / 835128 AraportID:AT5G50590 Length:299 Species:Arabidopsis thaliana


Alignment Length:300 Identity:81/300 - (27%)
Similarity:130/300 - (43%) Gaps:71/300 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVK 72
            ||:.:.:.:.:.||..:..|..:           ..:.|:||.|||:|||||..||...||.|..
plant    20 LLVFMPFSIFFKLLQFIRGCKES-----------EKVNGKVVIITGSSSGIGEHLAYEYARRGAY 73

  Fly    73 LVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNA 137
            |.|.|||.::|:.|.:.|..     |.:.||.|::.|:..:.:.|..:...::.|.|||.|||||
plant    74 LTLVARREDRLQVVADRCRK-----LGSPDVAVVRGDVSVIKDCKRFVQETISRFGRLDHLVNNA 133

  Fly   138 GRSQRASWTEVEIEVDRELFELDV----------FAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192
            |.:: |.:.|...|:...|..::.          ||:.||.:.           :|.|.|.:|.|
plant   134 GIAE-AKFFEDYSEISDVLPIVNTNFWGPVYATHFAIPHLKKT-----------KGKIIAVASPA 186

  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVEMR-KLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTA 256
            |:|.||....|.|:|.|:..:..:|::|:. ::.|::..||.|..                    
plant   187 GWSGVPRMSIYAASKAAMINFYETLRIELHPEVGVTIVFPGLIEN-------------------- 231

  Fly   257 NQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCAR 296
                      |:.....||.|.|  |..:..:...|.||:
plant   232 ----------GNTNPDLLAEKQD--WSQVVTIESAAECAK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 73/259 (28%)
adh_short 47..245 CDD:278532 66/208 (32%)
HSD4NP_199871.1 11beta-HSD1_like_SDR_c 45..295 CDD:187593 76/263 (29%)
PRK06181 47..291 CDD:235726 76/261 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.