DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and dhrs7b

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012825988.1 Gene:dhrs7b / 779695 XenbaseID:XB-GENE-946473 Length:323 Species:Xenopus tropicalis


Alignment Length:316 Identity:97/316 - (30%)
Similarity:149/316 - (47%) Gaps:29/316 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71
            |||..:..|.:|.||           .:.|.|..|   :..||.||||:||:||..|......|.
 Frog    25 LLLGSIGVYSLYKLL-----------QRLRSGAYL---QDAVVVITGATSGLGRECAKVFYAAGT 75

  Fly    72 KLVLSARRLEQLEQ-VQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVN 135
            :|||..|..|.|:. |||......:.....|..:|| .|:.|::...:..|.:|:...|:|:|:|
 Frog    76 RLVLCGRSEEGLKNLVQELSQMRIKSAQLHKPHMVI-FDLSDVEAVNSAANEILHLTGRVDILIN 139

  Fly   136 NAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFS 200
            |||.|.|.:..:.::.|||.:.:.:.|..|.|::.::...::..  ||||...||:.|...:||.
 Frog   140 NAGISYRGTILDTKVSVDRMVMDTNYFGPVALTKALIPSMIKNR--RGHIVVISSVQGKISIPFR 202

  Fly   201 PTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTAN--QKRM 261
            ..|.|:|||..|:...|:.||.  ::||::..||.|.|:....|.|| .|...|:...|  :.|.
 Frog   203 SAYSASKHATQAFFDCLRAEMSPYEIDVTVVNPGYIKTNLSLNAVTG-DGSNYGVMDNNTAEGRT 266

  Fly   262 TAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCARN--PTL--SKILAQLMTEKTL 313
            ..:....:.......:.:|...||.|.  ||...|.  ||:  |.:.|:...|:.|
 Frog   267 PEEVAQTVLRAVGERRKELLVAGLVPT--LAVYLRTLAPTIFFSFMAARAKKERKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 79/253 (31%)
adh_short 47..245 CDD:278532 68/200 (34%)
dhrs7bXP_012825988.1 11beta-HSD1_like_SDR_c 48..309 CDD:187593 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.