DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and Rdh8

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001162065.1 Gene:Rdh8 / 690953 RGDID:1589829 Length:312 Species:Rattus norvegicus


Alignment Length:199 Identity:66/199 - (33%)
Similarity:103/199 - (51%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QVVWITGASSGIGRALALSLA---RHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQM 108
            |.|.|:|.|||||..||:.||   |...::|.:.|.|.     ::|.|.||.|....|.:.|.|:
  Rat     6 QRVLISGCSSGIGLELAVQLAHDPRQRYQVVATMRDLG-----KKEPLEAAAGEALGKTLSVAQL 65

  Fly   109 DMLDLDEHKTHLNTVLNHFH--RLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLV 171
            |:.. ||..|:   .|:|..  ::|:||||||........::.:...:.:|..:.|..|.|.:.|
  Rat    66 DVCS-DESVTN---CLSHIEGGQVDILVNNAGVGLVGPLEDLSLATMQNVFNTNFFGAVRLVKAV 126

  Fly   172 VRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLD--VSLFAPGPI 234
            :.....:.  :|||...||:.|...|.|:..|.|:|.||..:..||.:::|:.:  :|:..|||:
  Rat   127 LPGMKRRR--QGHIVVVSSVMGLQGVMFNDVYAASKFALEGFFESLAIQLRQFNIFISMVEPGPV 189

  Fly   235 ATDF 238
            .|||
  Rat   190 ITDF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 66/199 (33%)
adh_short 47..245 CDD:278532 66/199 (33%)
Rdh8NP_001162065.1 NADB_Rossmann 8..262 CDD:304358 65/197 (33%)
adh_short 8..201 CDD:278532 65/197 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.