DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and zmp:0000001048

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005163825.1 Gene:zmp:0000001048 / 556557 ZFINID:ZDB-GENE-140106-8 Length:310 Species:Danio rerio


Alignment Length:223 Identity:67/223 - (30%)
Similarity:113/223 - (50%) Gaps:22/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VWITGASSGIGRALALSLARHGV---KLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDM 110
            |.:||.|||||.|:|:.||:..:   |:|.:.|.|:     :.|.|..|.|....:.:.:.|:|.
Zfish     6 VLVTGCSSGIGLAVAVRLAKDELRRFKVVATMRDLD-----RREALERAAGETLNRSLEIRQLDA 65

  Fly   111 LDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYF 175
            ...|..:..:|::.:  .::||||||||...........:...::||..:.|.:|.|    |:..
Zfish    66 TCEDSIRDCVNSLPD--RQVDVLVNNAGVGMIGPLECQSMSSMQDLFNTNFFGLVRL----VKEL 124

  Fly   176 VEQNGGR--GHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDV--SLFAPGPIAT 236
            :.|...|  |||...||:.|...:.|:..|.|:|.|:..:..||.|:..|.:|  :|..|||:.|
Zfish   125 LPQMKKRQSGHIIVMSSVLGIQGLLFNDLYAASKFAVEGFCESLAVQAMKFNVKMTLVEPGPVVT 189

  Fly   237 DFLQEAFTGSQGGKVGLSTANQKRMTAQ 264
            :|.::.:  .:...:.||..:::  |||
Zfish   190 EFERKVY--EEAETMDLSETDEE--TAQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 67/223 (30%)
adh_short 47..245 CDD:278532 62/202 (31%)
zmp:0000001048XP_005163825.1 NADB_Rossmann 4..260 CDD:304358 67/223 (30%)
adh_short 4..198 CDD:278532 62/204 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.