DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and RDH8

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_056540.3 Gene:RDH8 / 50700 HGNCID:14423 Length:311 Species:Homo sapiens


Alignment Length:197 Identity:60/197 - (30%)
Similarity:97/197 - (49%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QVVWITGASSGIGRALALSLARHGVK---LVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQM 108
            :.|.|:|.|||||..||:.||....|   :|.:.|.|.     ::|.|.||.|....:.:.|.|:
Human     6 RTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLG-----KKETLEAAAGEALGQTLTVAQL 65

  Fly   109 DMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVR 173
            |:...:.....|:.:..   .:||||||||.........:.:...:.:|:.:.|..|.|.:.|:.
Human    66 DVCSDESVAQCLSCIQG---EVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLP 127

  Fly   174 YFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLD--VSLFAPGPIAT 236
            ....:.  :|||...||:.|...|.|:..|.|:|.||..:..||.:::.:.:  :||..|||:.|
Human   128 GMKRRR--QGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVT 190

  Fly   237 DF 238
            :|
Human   191 EF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/197 (30%)
adh_short 47..245 CDD:278532 60/197 (30%)
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 60/197 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.