DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG5590

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:269 Identity:60/269 - (22%)
Similarity:113/269 - (42%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGL-LATKD 102
            ::...:.|:.::|||||.|||:.:||..||.|..:|::|:..|...::.....:||..: .|...
  Fly     2 INTGKLAGRTLFITGASRGIGKEIALKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGK 66

  Fly   103 VLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHL 167
            .....:|:.|..:.::.:...:..|..:|:::|||......:..:.:::....:..::......:
  Fly    67 AYPCVVDVRDEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLV 131

  Fly   168 SRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSP--TYCAAKHALNAYLLSLKVEMRKLDVSLFA 230
            |::.:.|..:.|  ..||...|......|..|.|  .|..||:.::..:|.:..|.:...:|:.|
  Fly   132 SKVCLPYLKKSN--HAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNA 194

  Fly   231 PGP---IATDFLQEAFTGSQGGK------------VGLSTANQKRMTAQRCGDLFAVALANKMDL 280
            ..|   |.|..: |..||....|            ..:.|...::.|.|...|...:..|...||
  Fly   195 LWPRTAIHTAAI-EMLTGPDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVDDEVLESAGITDL 258

  Fly   281 TWCGLFPVN 289
            |....|..|
  Fly   259 TEYACFREN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/264 (23%)
adh_short 47..245 CDD:278532 46/203 (23%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 53/242 (22%)
PRK08278 7..277 CDD:181349 60/264 (23%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435072
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.