DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG12171

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_649563.1 Gene:CG12171 / 40690 FlyBaseID:FBgn0037354 Length:257 Species:Drosophila melanogaster


Alignment Length:211 Identity:56/211 - (26%)
Similarity:102/211 - (48%) Gaps:16/211 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLV 105
            :.|.:.:|:.:||||||||...::.||:.|..|.:..|.|::|.:..|:.:||...     ..|.
  Fly     1 MPSFKDKVIIVTGASSGIGAGTSVLLAKLGGLLTIVGRNLDKLNETAEQIVAAGGA-----PALQ 60

  Fly   106 IQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRL 170
            :..|:....:.:..::..|....|:||||||||..:..|.....:|....:...:|.::..|:.|
  Fly    61 VAADINSESDVQGIVSATLAKHGRIDVLVNNAGILELGSIENTSLEQFDRVMNTNVRSLYQLTHL 125

  Fly   171 VVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAY--LLSLKVEMRKLDVSLFAPGP 233
            |....::.   :|:|...||:.|....|....|..:|.|::.:  .::|::..:.:.|:...||.
  Fly   126 VTPELIKT---KGNIVNVSSVNGIRSFPGVLAYNVSKAAVDQFTRCVALELAPKGVRVNSVNPGV 187

  Fly   234 IATDFL------QEAF 243
            |.|:..      |||:
  Fly   188 IITELQRRGGLDQEAY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 55/208 (26%)
adh_short 47..245 CDD:278532 55/205 (27%)
CG12171NP_649563.1 fabG 2..251 CDD:235975 56/210 (27%)
NADB_Rossmann 4..254 CDD:304358 55/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
32.840

Return to query results.
Submit another query.