DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and hsd11b1la

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_956617.2 Gene:hsd11b1la / 393293 ZFINID:ZDB-GENE-040426-1002 Length:287 Species:Danio rerio


Alignment Length:233 Identity:70/233 - (30%)
Similarity:111/233 - (47%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLDCNVAL------WYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQ 82
            ||.|::.:      |....|  :..|::|..|.:||||:|||..||...||.|.::|::|||...
Zfish     7 LLLCSICVAFIAVRWSAPSF--NEESLKGARVLVTGASTGIGEQLAYHYARLGAQIVITARRGNV 69

  Fly    83 LEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLV-NNAGRSQRASWT 146
            ||||..:|    |.:.|.| ...|..||.:..:....:...:.....||.|| |:.|.|....| 
Zfish    70 LEQVVSKC----REMGAQK-AFYIPADMANPSDADLVVKYAIEQLGGLDYLVLNHIGPSPYQMW- 128

  Fly   147 EVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALN 211
            :.:::..|.|.|::..:.:.:::..:....:   .:|.|...||:.|....||:..|.:.|.|||
Zfish   129 DGDVQHTRWLLEVNFLSYLQMAQKALPTLEK---SKGSIVVVSSLLGKICGPFALPYASTKFALN 190

  Fly   212 AYLLSLKVE--MRKLDVS--LFAPGPIATDFLQEAFTG 245
            .:...|:.|  |:|.:||  :...|.|.||...|...|
Zfish   191 GFFGGLQNELAMQKSNVSITICILGLIDTDSAMEKIKG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 64/207 (31%)
adh_short 47..245 CDD:278532 62/202 (31%)
hsd11b1laNP_956617.2 11beta-HSD1_like_SDR_c 31..278 CDD:187593 64/207 (31%)
adh_short 36..229 CDD:278532 63/202 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.