DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG10672

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:225 Identity:52/225 - (23%)
Similarity:104/225 - (46%) Gaps:11/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVL 104
            ::..:.|:|..:|.::.|||.|:|..||..|..:|:|:|:.:.:    :..||..|.|  ..:|.
  Fly    65 TMKRLAGKVAVVTASTDGIGFAIAKRLAEDGAAVVISSRKQKNV----DSALAELRKL--NLNVH 123

  Fly   105 VIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWT-EVEIEVDRELFELDVFAVVHLS 168
            .::..:.:.::.|......::.|.:|::||:||..:...... |.:.:|..::|:::|.:...|:
  Fly   124 GLKCHVSEPEDRKQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLA 188

  Fly   169 RLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEM--RKLDVSLFAP 231
            :..:....:|.  ...|...|||||:........|..:|.||.....:...::  ..:.|:..||
  Fly   189 KEALPLLRQQK--NSSIVFVSSIAGYDAFELLGAYSVSKTALIGLTKAAAKDLAPEGIRVNCLAP 251

  Fly   232 GPIATDFLQEAFTGSQGGKVGLSTANQKRM 261
            |.|.|.|.:..:......:..||.....|:
  Fly   252 GVIRTKFSKALYENESANEAALSKIPMGRL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 52/221 (24%)
adh_short 47..245 CDD:278532 48/200 (24%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 52/223 (23%)
fabG 67..316 CDD:235975 52/223 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435074
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.