DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and HSD11B1L

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001254797.1 Gene:HSD11B1L / 374875 HGNCID:30419 Length:333 Species:Homo sapiens


Alignment Length:226 Identity:65/226 - (28%)
Similarity:96/226 - (42%) Gaps:46/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVI 106
            :|::|..|.:|||::|:|..||...||.|..|||:|.....|::|...|    |.|.|.| |..|
Human    72 ASLQGARVLLTGANAGVGEELAYHYARLGSHLVLTAHTEALLQKVVGNC----RKLGAPK-VFYI 131

  Fly   107 QMDMLDLDEHKTHLNTVLNHFHRLDVLVNN------AGRSQRASWTEVEIEVDRELFELDVFAVV 165
            ..||...:..::.:...|:....||.||.|      ||...|:.      :..|.|.:::..:.|
Human   132 AADMASPEAPESVVQFALDKLGGLDYLVLNHIGGAPAGTRARSP------QATRWLMQVNFVSYV 190

  Fly   166 HLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSL-- 228
            .|:.   |........:|.:...||:.|..|..||..|.|||.||:.:..||:.|:...||::  
Human   191 QLTS---RALPSLTDSKGSLVVVSSLLGRVPTSFSTPYSAAKFALDGFFGSLRRELDVQDVNVAI 252

  Fly   229 ------------------------FAPGPIA 235
                                    .||||.|
Human   253 TMCVLGLRDRASAAEAVRGVTRVKAAPGPKA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 64/224 (29%)
adh_short 47..245 CDD:278532 63/221 (29%)
HSD11B1LNP_001254797.1 GVQW 3..>26 CDD:290611
NADB_Rossmann 74..302 CDD:304358 64/224 (29%)
PRK08251 78..302 CDD:181324 63/220 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.