Sequence 1: | NP_608616.2 | Gene: | CG31937 / 326177 | FlyBaseID: | FBgn0031360 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254797.1 | Gene: | HSD11B1L / 374875 | HGNCID: | 30419 | Length: | 333 | Species: | Homo sapiens |
Alignment Length: | 226 | Identity: | 65/226 - (28%) |
---|---|---|---|
Similarity: | 96/226 - (42%) | Gaps: | 46/226 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 SSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVI 106
Fly 107 QMDMLDLDEHKTHLNTVLNHFHRLDVLVNN------AGRSQRASWTEVEIEVDRELFELDVFAVV 165
Fly 166 HLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSL-- 228
Fly 229 ------------------------FAPGPIA 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31937 | NP_608616.2 | NADB_Rossmann | 44..293 | CDD:304358 | 64/224 (29%) |
adh_short | 47..245 | CDD:278532 | 63/221 (29%) | ||
HSD11B1L | NP_001254797.1 | GVQW | 3..>26 | CDD:290611 | |
NADB_Rossmann | 74..302 | CDD:304358 | 64/224 (29%) | ||
PRK08251 | 78..302 | CDD:181324 | 63/220 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1205 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D906746at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |