DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and Dhrs11

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038942294.1 Gene:Dhrs11 / 360583 RGDID:1307935 Length:299 Species:Rattus norvegicus


Alignment Length:179 Identity:50/179 - (27%)
Similarity:93/179 - (51%) Gaps:6/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMD 109
            |.::..:||||.|||.|:|.:|.:.|:|:|..||.:..:|::..||.:|  |...|  ::..:.|
  Rat    80 RDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSA--GYPGT--LIPYRCD 140

  Fly   110 MLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRY 174
            :.:.::..:..:.|.:....:|:.:||||.::..|.........:::|.::|.|:...:|...:.
  Rat   141 LSNEEDILSMFSAVRSQHSGVDICINNAGMARPDSLLSGSTSGWKDMFNVNVLALSICTREAYQS 205

  Fly   175 FVEQNGGRGHIAATSSIAGFSPVPFSPT--YCAAKHALNAYLLSLKVEM 221
            ..|:|...|||...:|:.|....|.|..  |.|.|:|:.|....|:.|:
  Rat   206 MKERNVDDGHIININSMCGHRVPPQSVIHFYSATKYAVTALTEGLRQEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 50/179 (28%)
adh_short 47..245 CDD:278532 49/177 (28%)
Dhrs11XP_038942294.1 Mgc4172-like_SDR_c 76..295 CDD:187601 50/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.