DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and dhs-6

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:257 Identity:60/257 - (23%)
Similarity:106/257 - (41%) Gaps:46/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGL-LATKDVLVIQMD 109
            |:.|.|||||.|||:.:||.||:.|..:|::|:......::.....:||..: .|....|...:|
 Worm     9 GRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALPCIVD 73

  Fly   110 MLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVH------LS 168
            :.|....|..:...:..|..:|:|:|||   ...|.|:.|   :.|:...|:...::      ::
 Worm    74 VRDEASVKASVEEAVKKFGGIDILINNA---SAISLTDTE---NTEMKRYDLMHSINTRGTFLMT 132

  Fly   169 RLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPT--------YCAAKHALNAYLLSLKVEMRKLD 225
            :..:.|.  ::|...|      :...||.....|        |..||:.::..:|....|.|...
 Worm   133 KTCLPYL--KSGKNPH------VLNISPPLLMETRWFANHVAYTMAKYGMSMCVLGQHEEFRPHG 189

  Fly   226 VSLFAPGPI------ATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLT 281
            :::.|..|:      |.:.|.:     :||:.|      .|..:......:||...|..|.|
 Worm   190 IAVNALWPLTAIWTAAMEMLSD-----KGGEAG------SRKPSIMADAAYAVLSKNSKDFT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/257 (23%)
adh_short 47..245 CDD:278532 50/218 (23%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 60/257 (23%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.