DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG40485

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001036313.1 Gene:CG40485 / 3355165 FlyBaseID:FBgn0069973 Length:247 Species:Drosophila melanogaster


Alignment Length:211 Identity:64/211 - (30%)
Similarity:107/211 - (50%) Gaps:21/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLD 112
            |..:||||||||.|:...|...||.:|..|||:::|||::||.....|..|.     ::|.|:.|
  Fly     8 VAVVTGASSGIGAAITRKLISAGVMVVALARRMDRLEQLREELPQDRRSRLR-----IMQCDVSD 67

  Fly   113 LDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYF-- 175
            :.......:.|......:|:|:||||:........:.::..:::.:.:|..||:.::   |.|  
  Fly    68 VSSVNAVFDAVQGDLGNVDILINNAGKLSGGQLLTMSVDTVQQMLQTNVMGVVYCTQ---RAFES 129

  Fly   176 VEQNGGRGHIAATSSIAG---FSPVPFSP----TYCAAKHALNAYLLSLKVEMR----KLDVSLF 229
            :.|...:||:...:||.|   |:|:|.|.    .|.|.|||:.|.....:.|||    |:.|:..
  Fly   130 MRQRQSKGHVVLINSIVGHYIFNPLPGSQQELNMYPATKHAITALTELFRQEMRDFKTKVKVTSI 194

  Fly   230 APGPIATDFLQEAFTG 245
            :||.:.|:.:...:.|
  Fly   195 SPGLVDTELVPLDYKG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 64/211 (30%)
adh_short 47..245 CDD:278532 63/209 (30%)
CG40485NP_001036313.1 YdfG 1..247 CDD:226674 64/211 (30%)
NADB_Rossmann 1..242 CDD:304358 64/211 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.