DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and HSD17B1

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001317148.1 Gene:HSD17B1 / 3292 HGNCID:5210 Length:329 Species:Homo sapiens


Alignment Length:285 Identity:77/285 - (27%)
Similarity:118/285 - (41%) Gaps:30/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MRGQVVWITGASSGIGRALALSLA---RHGVKLVLSARRLEQLEQVQE--ECLAAARGLLATKDV 103
            |...||.|||.|||||..||:.||   ....|:..:.|.|:...::.|  ..||...|.|.|   
Human     1 MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSLET--- 62

  Fly   104 LVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLS 168
              :|:|:.|..........|..  .|:||||.|||.........:..:....:.:::|...|   
Human    63 --LQLDVRDSKSVAAARERVTE--GRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV--- 120

  Fly   169 RLVVRYFVE-QNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDV---SLF 229
            |::..:..: :..|.|.:..|.|:.|...:||:..|||:|.||.....||.|.:....|   ||.
Human   121 RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHSLSLI 185

  Fly   230 APGPIATDFLQEAFTGSQG--GKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLA 292
            ..||:.|.|:::.....:.  .:..:.|.::..........:|..|..|..::.     .|.|.|
Human   186 ECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVA-----EVFLTA 245

  Fly   293 YCARNPTLSKILAQLMTEKTLNKIR 317
            ..|..||    |....||:.|..:|
Human   246 LRAPKPT----LRYFTTERFLPLLR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 68/259 (26%)
adh_short 47..245 CDD:278532 61/206 (30%)
HSD17B1NP_001317148.1 NADB_Rossmann 4..262 CDD:304358 74/276 (27%)
adh_short 5..198 CDD:278532 61/202 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.