DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and antdh

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_572695.2 Gene:antdh / 32058 FlyBaseID:FBgn0026268 Length:250 Species:Drosophila melanogaster


Alignment Length:245 Identity:62/245 - (25%)
Similarity:114/245 - (46%) Gaps:34/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMD 109
            :.:|..:||||||||.|:|..|...|:.:|..|||:::::::|.|..|..||.|     ..:..|
  Fly     5 QNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQRELPAEKRGKL-----FALYCD 64

  Fly   110 MLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRY 174
            :.:........:.::.....:||||||||..|.....::...|.:::.:.::..:|..::..||.
  Fly    65 VGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYLVDMNPAVMQQVLQTNIMGIVLCTQRAVRS 129

  Fly   175 FVEQNGGRGHIAATSSIAGFSPV-------PFSPTYCAAKHALNAYLLSLKVEM----RKLDVSL 228
            ..|:... ||:...:||.|...:       |....|..:|||:.|.....:.|.    .::.::.
  Fly   130 MRERKFD-GHVVLINSILGHKTMTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITS 193

  Fly   229 FAPGPIATDFLQEAFTGSQGGKVGLSTANQKRM-----TAQRCGDLFAVA 273
            .:||.:.|:.:.::          :..|.:.||     .||  |.|:|:|
  Fly   194 VSPGVVDTEIVPDS----------IREAIKDRMLHSEDIAQ--GVLYAIA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 62/245 (25%)
adh_short 47..245 CDD:278532 53/208 (25%)
antdhNP_572695.2 YdfG 1..250 CDD:226674 62/245 (25%)
NADB_Rossmann 1..245 CDD:304358 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.