DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG31548

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_730974.1 Gene:CG31548 / 318794 FlyBaseID:FBgn0051548 Length:256 Species:Drosophila melanogaster


Alignment Length:223 Identity:62/223 - (27%)
Similarity:106/223 - (47%) Gaps:24/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDM 110
            |:||.|||||||||.|.|:..|::|..|.|:.|.:|.|::|..||...::    ::..||:....
  Fly     5 GKVVLITGASSGIGAATAIKFAKYGACLALNGRNVENLKKVAAECSKVSQ----SQPALVVGDIA 65

  Fly   111 LDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYF 175
            .:.|..:....| |..:.:|||||||||..:..:.....:|....:...::.|:.||:.|.....
  Fly    66 KEADTQRIWSET-LQQYGKLDVLVNNAGIIETGTIETTSLEQYDRVMNTNLRAIYHLTMLATPEL 129

  Fly   176 VEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAY--LLSLKVEMRKLDVSLFAPGPIATD- 237
            |:.   :|:|...||:.|....|....|..:|..::.:  .::|::..:.:.|:...||...|: 
  Fly   130 VKT---KGNIVNVSSVNGIRSFPGVLAYNISKMGVDQFTRCVALELAAKGVRVNCVNPGVTVTNL 191

  Fly   238 -------------FLQEAFTGSQGGKVG 252
                         ||:.:.|....|:.|
  Fly   192 HARGGMDAETYKKFLEHSKTTHALGRPG 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 62/223 (28%)
adh_short 47..245 CDD:278532 58/213 (27%)
CG31548NP_730974.1 fabG 1..250 CDD:235975 62/223 (28%)
NADB_Rossmann 3..253 CDD:304358 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X68
32.840

Return to query results.
Submit another query.