DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and sni

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster


Alignment Length:249 Identity:57/249 - (22%)
Similarity:106/249 - (42%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VWITGASSGIGRALA---LSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDM 110
            :.|||.:.|:|..|.   |:|.:....|..:.|..||.:::::  ||...     .::.::::|:
  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELED--LAKNH-----SNIHILEIDL 61

  Fly   111 LDLDEHKTHLNTV--LNHFHRLDVLVNNAGRSQR-ASWTEVEIEVDRELFELDVFAVVHLSRL-- 170
            .:.|.:...:..:  :.....|:||.||||.:.: |..|.|..:...:..:.:....:.|::.  
  Fly    62 RNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACL 126

  Fly   171 -VVRYFVEQNG------GRGHIAATSSIAG----------FSPVPFSPTYCAAKHALNAYLLSLK 218
             :::...:.|.      ||..|...|||.|          ::       |..:|.||||...||.
  Fly   127 PLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYA-------YRTSKSALNAATKSLS 184

  Fly   219 VEM---RKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTA-NQKRMTAQRCGD 268
            |::   |.:.|||. ||.:.||.      |.....:.:.|: .|...|..:.|:
  Fly   185 VDLYPQRIMCVSLH-PGWVKTDM------GGSSAPLDVPTSTGQIVQTISKLGE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 57/249 (23%)
adh_short 47..245 CDD:278532 52/223 (23%)
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 57/249 (23%)
adh_short 4..209 CDD:278532 53/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.