DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and CG13377

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:302 Identity:58/302 - (19%)
Similarity:109/302 - (36%) Gaps:67/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFLEFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALS 65
            |:.|.....||.|:.:...|| |.|.|.|.   :.....:..|...:||.||.|.:.:|..|...
  Fly     4 MTMLVLGFQLLALFSIAGALL-IYLICKVR---EDSASANADSHPSRVVLITSADTALGLQLCTH 64

  Fly    66 LARHGVKLVLSARRLE------------QLEQVQEECLAAARGLLATKDVLVIQMDMLDLD---E 115
            ||..|.::....:..:            ::.:..||.:|..        ::.:::|:...|   |
  Fly    65 LANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSEEPIAGT--------IIPMRLDVTREDVLRE 121

  Fly   116 HKTHLNTVLNHFHR-LDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQN 179
            ....:...||...| :..::|.:|...|.......::....:...::...:.:::..| .|:...
  Fly   122 ATVIIGANLNADERGIAAVINTSGSVFRGQVESQNVQQWEHMLRTNILGTLRVAKAFV-CFLRPT 185

  Fly   180 GGR----GHIAATSSI--AGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGPIATDF 238
            .||    |.::...:.  .|...|.|:    |::.|::.....|:.|:....||:          
  Fly   186 RGRLLYLGGVSGGGNARNEGDGLVAFN----ASRVAVDKCAEELRKELHPYGVSV---------- 236

  Fly   239 LQEAFTGSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDL 280
                        |.|.|..   |||:   .|:...:|..|.|
  Fly   237 ------------VALDTCG---MTAE---SLYKAPVAQTMSL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 46/259 (18%)
adh_short 47..245 CDD:278532 36/219 (16%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 40/237 (17%)
NADB_Rossmann 46..>237 CDD:304358 36/225 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.