DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and Dhrs7c

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001258527.1 Gene:Dhrs7c / 287411 RGDID:1306989 Length:311 Species:Rattus norvegicus


Alignment Length:227 Identity:57/227 - (25%)
Similarity:111/227 - (48%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71
            :|:|.:|...|..||:|..:.: .||.|       |:::.:||.||.|.||:|:..|......|.
  Rat     6 VLMLPLLLLGVSGLLFIYQEAS-RLWSK-------SAVQNKVVVITDALSGLGKECARVFNAGGA 62

  Fly    72 KLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNN 136
            :|||..:..|.||.:.....:.|.........||: :|:.|:...:.....||:.:..:|:|:||
  Rat    63 RLVLCGKNWEGLESLYAALTSVADPSKTFTPKLVL-LDLSDISCVEDVAKEVLDCYGCVDILINN 126

  Fly   137 AGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSP 201
            |....:....::.:|:|:::.:.:.|..:..:::::...:.:.  .|.|...::|.....:||..
  Rat   127 ASVKVKGPAHKISLELDKKIMDANYFGPITFTKVLLPNMISRR--TGQIVLVNNIQAKFGIPFRT 189

  Fly   202 TYCAAKHALNAYLLSLKVEMRKLDVSLFAPGP 233
            .|.|:|||:..:...|:.|:.:.||.:....|
  Rat   190 AYAASKHAVMGFFDCLRAEVEEYDVVVSTVSP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 46/190 (24%)
adh_short 47..245 CDD:278532 46/187 (25%)
Dhrs7cNP_001258527.1 11beta-HSD1_like_SDR_c 35..296 CDD:187593 46/190 (24%)
PRK06181 37..293 CDD:235726 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.