DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and DHRS7B

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_011522088.1 Gene:DHRS7B / 25979 HGNCID:24547 Length:334 Species:Homo sapiens


Alignment Length:285 Identity:84/285 - (29%)
Similarity:134/285 - (47%) Gaps:38/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFLEFLLLLLVLYYVVYVL-LWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALAL 64
            |.|:....:|.:|:..:.|. |:.||.     |.:.:     :.:|..||.||||:||:|:..|.
Human    63 MDFITSTAILPLLFGCLGVFGLFRLLQ-----WVRGK-----AYLRNAVVVITGATSGLGKECAK 117

  Fly    65 SLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHR 129
            .....|.||||..|....||::..|..|:....:.|....::..|:.|..........:|..|..
Human   118 VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGY 182

  Fly   130 LDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGF 194
            :|:||||||.|.|.:..:..::||:.:.|.:.|..|.|::.::...:::.  :|||.|.|||.|.
Human   183 VDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRR--QGHIVAISSIQGK 245

  Fly   195 SPVPFSPTYCAAKHALNAYLLSLKVEMR--KLDVSLFAPGPIATDFLQEAFT--GSQ-------- 247
            ..:||...|.|:|||..|:...|:.||.  :::|::.:||.|.|:....|.|  ||.        
Human   246 MSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSSYGHHHSPG 310

  Fly   248 ----GGKVGLSTANQKRMTAQRCGD 268
                ||..|.|..         ||:
Human   311 PKPCGGGPGCSCC---------CGE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 75/241 (31%)
adh_short 47..245 CDD:278532 66/201 (33%)
DHRS7BXP_011522088.1 11beta-HSD1_like_SDR_c 97..>304 CDD:187593 69/208 (33%)
adh_short 101..294 CDD:278532 64/194 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.