DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and Hsd11b1

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_038946302.1 Gene:Hsd11b1 / 25116 RGDID:2834 Length:1274 Species:Rattus norvegicus


Alignment Length:260 Identity:73/260 - (28%)
Similarity:119/260 - (45%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLE 84
            ||.:|:.| :..:|.:........::|:.|.:||||.||||.:|..|::.|..:||:||..|.|:
  Rat     5 LLPVLVLC-LGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQ 68

  Fly    85 QVQEECL----AAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASW 145
            :|...||    |:|..:..|.:      ||...:........:|.   .||:|:.|.......|.
  Rat    69 KVVSRCLELGAASAHYIAGTME------DMAFAERFVVEAGKLLG---GLDMLILNHITQTTMSL 124

  Fly   146 TEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHAL 210
            ...:|...|...|::..:.|.||...:....:.||.   ||..||:||....|...:|.|:|.||
  Rat   125 FHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGS---IAIISSMAGKMTQPLIASYSASKFAL 186

  Fly   211 NAYLLSLKVE--MRKLDVSL------FAPGPIATDFLQEAFTGSQGGKVGLSTANQKRMTAQRCG 267
            :.:..:::.|  |.|::||:      |......|...|::|..:  |::.||...|:     .||
  Rat   187 DGFFSTIRKEHLMTKVNVSITLCVLGFIDTGRQTSASQDSFVNT--GRIQLSKGLQR-----DCG 244

  Fly   268  267
              Rat   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 68/236 (29%)
adh_short 47..245 CDD:278532 61/209 (29%)
Hsd11b1XP_038946302.1 11beta-HSD1_like_SDR_c 28..327 CDD:187593 68/236 (29%)
Smc <482..>650 CDD:224117
RT_nLTR_like 710..972 CDD:238827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.