DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and DHRS7C

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001207422.1 Gene:DHRS7C / 201140 HGNCID:32423 Length:312 Species:Homo sapiens


Alignment Length:227 Identity:58/227 - (25%)
Similarity:114/227 - (50%) Gaps:10/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71
            :|:|.:|...:..||:|..:.: .||.|       |:::.:||.||.|.||:|:..|......|.
Human     6 MLMLPLLLLGISGLLFIYQEVS-RLWSK-------SAVQNKVVVITDAISGLGKECARVFHTGGA 62

  Fly    72 KLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNN 136
            :|||..:..|:||.:.:..::.|.....|....::.:|:.|:.........||:.:..:|:|:||
Human    63 RLVLCGKNWERLENLYDALISVADPSKQTFTPKLVLLDLSDISCVPDVAKEVLDCYGCVDILINN 127

  Fly   137 AGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSP 201
            |....:....::.:|:|:::.:.:.|..:.|::.::...:.:.  .|.|...::|.|...:||..
Human   128 ASVKVKGPAHKISLELDKKIMDANYFGPITLTKALLPNMISRR--TGQIVLVNNIQGKFGIPFRT 190

  Fly   202 TYCAAKHALNAYLLSLKVEMRKLDVSLFAPGP 233
            ||.|:|||...:...|:.|:.:.||.:....|
Human   191 TYAASKHAALGFFDCLRAEVEEYDVVISTVSP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 48/190 (25%)
adh_short 47..245 CDD:278532 48/187 (26%)
DHRS7CNP_001207422.1 11beta-HSD1_like_SDR_c 35..297 CDD:187593 48/190 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.