DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and Dhrs11

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_808232.2 Gene:Dhrs11 / 192970 MGIID:2652816 Length:260 Species:Mus musculus


Alignment Length:208 Identity:54/208 - (25%)
Similarity:103/208 - (49%) Gaps:26/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMD 109
            |.::..:||||.|||.|:|.:|.:.|:|:|..||.:..:|::..||.:|  |...|  ::..:.|
Mouse    10 RDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSA--GYPGT--LIPYRCD 70

  Fly   110 MLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQ--------RASWTEVEIEVDRELFELDVFAVVH 166
            :.:.::..:..:.|.:....:|:.:||||.::        .:.|        :::|.::|.|:..
Mouse    71 LSNEEDILSMFSAVRSQHSGVDICINNAGMARPDTLLSGSTSGW--------KDMFNVNVLALSI 127

  Fly   167 LSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPT--YCAAKHALNAYLLSLKVEMRK----LD 225
            .:|...:...|:|...|||...:|:.|....|.|..  |.|.|:|:.|....|:.|:.:    :.
Mouse   128 CTREAYQSMKERNIDDGHIININSMCGHRVPPQSVIHFYSATKYAVTALTEGLRQELLEAQTHIR 192

  Fly   226 VSLFAPGPIATDF 238
            .:..:||.:.|.|
Mouse   193 ATCISPGLVETQF 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 54/208 (26%)
adh_short 47..245 CDD:278532 53/206 (26%)
Dhrs11NP_808232.2 YdfG 6..259 CDD:226674 54/208 (26%)
Mgc4172-like_SDR_c 6..256 CDD:187601 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.