DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and dhs-12

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_501850.1 Gene:dhs-12 / 177888 WormBaseID:WBGene00000975 Length:255 Species:Caenorhabditis elegans


Alignment Length:252 Identity:58/252 - (23%)
Similarity:101/252 - (40%) Gaps:54/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MRGQVVWITGASSGIGRALALSLAR-HGVK-LVLSARRLEQLEQVQEECLAAARGLLATKDVLVI 106
            |..:.::||||:.|||..|...|.: .||: ||..||.::..:::|....|.||..|...||   
 Worm     1 MAPKTIFITGANRGIGLGLVRELLKVPGVEALVAGARNIDGAKELQSLAKADARLHLIAVDV--- 62

  Fly   107 QMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLV 171
             .:...|:.....::.::.. ..|::|:||||..:....|....... .|..:||.||..|  |.
 Worm    63 -SNDGSLENSVKSVSGIVGD-RGLNLLINNAGLIESYGTTSAPNRAS-VLHCIDVNAVSAL--LA 122

  Fly   172 VRYFVE-QNGGRGHIAATS--------------------SIAGFSPVPFSPTYCAAKHALNAYLL 215
            .::|:. ......|::..|                    ::.|..|......|..:|.|:.::..
 Worm   123 SQHFLPLLQKAASHVSGDSLTPDRAAIVNIGSDCASQALNLRGSGPSNSLLAYKMSKVAMLSFSR 187

  Fly   216 SLKVEMRKLDVSLFA----PGPIATDF--------LQEAFT-----------GSQGG 249
            |:..:.::|::.:..    ||.:.||.        :.|:.|           |.|||
 Worm   188 SMAADFKRLEIPVLITNIHPGWVQTDMGGSNAEISVDESVTKIVASIAKLNGGHQGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 58/252 (23%)
adh_short 47..245 CDD:278532 53/243 (22%)
dhs-12NP_501850.1 adh_short 4..217 CDD:278532 51/220 (23%)
carb_red_sniffer_like_SDR_c 6..254 CDD:187586 57/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160155986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.