Sequence 1: | NP_608616.2 | Gene: | CG31937 / 326177 | FlyBaseID: | FBgn0031360 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501850.1 | Gene: | dhs-12 / 177888 | WormBaseID: | WBGene00000975 | Length: | 255 | Species: | Caenorhabditis elegans |
Alignment Length: | 252 | Identity: | 58/252 - (23%) |
---|---|---|---|
Similarity: | 101/252 - (40%) | Gaps: | 54/252 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 MRGQVVWITGASSGIGRALALSLAR-HGVK-LVLSARRLEQLEQVQEECLAAARGLLATKDVLVI 106
Fly 107 QMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLV 171
Fly 172 VRYFVE-QNGGRGHIAATS--------------------SIAGFSPVPFSPTYCAAKHALNAYLL 215
Fly 216 SLKVEMRKLDVSLFA----PGPIATDF--------LQEAFT-----------GSQGG 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31937 | NP_608616.2 | NADB_Rossmann | 44..293 | CDD:304358 | 58/252 (23%) |
adh_short | 47..245 | CDD:278532 | 53/243 (22%) | ||
dhs-12 | NP_501850.1 | adh_short | 4..217 | CDD:278532 | 51/220 (23%) |
carb_red_sniffer_like_SDR_c | 6..254 | CDD:187586 | 57/247 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160155986 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |