DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and T25G12.13

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001257285.1 Gene:T25G12.13 / 13224720 WormBaseID:WBGene00219274 Length:310 Species:Caenorhabditis elegans


Alignment Length:263 Identity:76/263 - (28%)
Similarity:128/263 - (48%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGV 71
            :|::.:..|:.|.||      |.|:  .....:|..:::.::|.|||||||:|::||..|.:.|.
 Worm    15 VLVVTICLYLAYNLL------NKAI--PGAHNLSKLNVKNKIVVITGASSGLGKSLAFELYKRGA 71

  Fly    72 KLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKT--HLNTVLN-------HF 127
            :::|.||..|:|:::..|         .||        ...|:::|.  :...:.|       ..
 Worm    72 QVILLARSTEKLKEICAE---------LTK--------TFPLNKNKPTYYFFDITNPDKAPWAQI 119

  Fly   128 HRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192
            .::|||:||||.|.|.|..:..:.:.|:..|.::|..|.    |.:..:.:....|.|..||||.
 Worm   120 PKVDVLINNAGMSNRGSCQDTTMAIHRKAMETNLFGHVQ----VTQSLLSKLSPDGCIVVTSSIQ 180

  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGPIATDFLQEAFTGSQGGKVGLSTAN 257
            |...:|:..:|.|:||||..|...|:.|.:.|.:.:.:.|.|.|.|...|. .:.|..||:...|
 Worm   181 GKVAIPYRGSYSASKHALQGYFDCLRAEHKNLHILVVSAGYINTGFGSRAL-DTDGKVVGVEDEN 244

  Fly   258 QKR 260
            ||:
 Worm   245 QKK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 68/226 (30%)
adh_short 47..245 CDD:278532 62/206 (30%)
T25G12.13NP_001257285.1 NADB_Rossmann 44..290 CDD:304358 68/226 (30%)
PRK06181 46..289 CDD:235726 68/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.