DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and hsd11b1

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_031752637.1 Gene:hsd11b1 / 100489345 XenbaseID:XB-GENE-960491 Length:294 Species:Xenopus tropicalis


Alignment Length:235 Identity:62/235 - (26%)
Similarity:115/235 - (48%) Gaps:33/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFLEFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALS 65
            |:.|:.|::...::..||             :|.:......:.::|:.|.:||||||||..:|..
 Frog     1 MALLKALVVFTGIFLAVY-------------FYSAGDVFEPAMLKGKRVIVTGASSGIGEQMAYH 52

  Fly    66 LARHGVKLVLSARRLEQLEQVQEEC----LAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNH 126
            ||:.|..::::||..|:|::|..:|    .|:|..:..:.|.    |....|..||..     |.
 Frog    53 LAKMGSHILITARTEEKLKKVVAQCTHLGAASAHYIAGSMDT----MTFAKLVVHKAE-----NL 108

  Fly   127 FHRLDVLV-NNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSS 190
            |..||:|: |:.|.:. ..:.:..|:..|:|.|::|.:...::...:....:.|   |::...||
 Frog   109 FGGLDMLILNHIGHTY-FGYFDGNIDHVRDLLEINVLSYATMTVAALPMLKKSN---GNVVVVSS 169

  Fly   191 IAGFSPVPFSPTYCAAKHALNAYLLSLKVE--MRKLDVSL 228
            :||...:|.:..|...|.||:.:..||::|  .:.:|||:
 Frog   170 VAGKIGLPLTVPYSTTKFALDGFFSSLRMEFIQQNIDVSI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 56/192 (29%)
adh_short 47..245 CDD:278532 55/189 (29%)
hsd11b1XP_031752637.1 11beta-HSD1_like_SDR_c 31..279 CDD:187593 56/192 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.