DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and hsd11b1lb

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_009297199.1 Gene:hsd11b1lb / 100333777 ZFINID:ZDB-GENE-101130-4 Length:281 Species:Danio rerio


Alignment Length:234 Identity:68/234 - (29%)
Similarity:115/234 - (49%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLE 81
            |::|:.:|    .:|.::..|  ...|:||..|.|||||||||..:|...|:.|.::|::|||||
Zfish     7 VFLLIAVL----TSLMWRDTF--DPESIRGTRVLITGASSGIGEQMAYHYAKFGAEIVITARRLE 65

  Fly    82 QLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLV-NNAGRSQRASW 145
            .|::|.::|     ..|..|.::.:..||.|..:.:..|...:.....||.|| |:.|.:....|
Zfish    66 ALKKVTQKC-----EKLGAKKIMYVTGDMSDPADPERVLKYTIEKLGGLDFLVLNHVGNTNVGLW 125

  Fly   146 TEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHAL 210
            .. :.:..|.|.:::..:.|.::...:. .:|.:|  |.|...||:||....||...|.:.|.|:
Zfish   126 NR-DADHVRSLMQVNFVSYVQMAGAALP-VLETSG--GSIIVVSSLAGKIASPFVTPYSSTKFAM 186

  Fly   211 NAYLLSLKVEM----RKLDVSLFAPGPIATDFLQEAFTG 245
            |.:..:|:.|:    ..:.||:...|.|.|:.......|
Zfish   187 NGFFGALQKELAIQKSNVSVSIQILGLIDTESAMRKIRG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 62/207 (30%)
adh_short 47..245 CDD:278532 59/202 (29%)
hsd11b1lbXP_009297199.1 NADB_Rossmann 28..273 CDD:304358 62/207 (30%)
adh_short 33..226 CDD:278532 60/202 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.