DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and dhrs7c

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_012826975.2 Gene:dhrs7c / 100135266 XenbaseID:XB-GENE-5956201 Length:704 Species:Xenopus tropicalis


Alignment Length:236 Identity:63/236 - (26%)
Similarity:119/236 - (50%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSFLEFL---LLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRAL 62
            |.||.||   ||:|.:..:||:...:     |.|       :|.|:::.:||.||.|.||:|:..
 Frog     1 MGFLTFLIVPLLILGISGIVYIYREV-----VRL-------MSRSALKNKVVVITDAISGLGKEC 53

  Fly    63 ALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHF 127
            :......|.:|||..:..|:||.:.:..::.|...:.....||: :|:.|::..:.....:.:.:
 Frog    54 SRVFHSAGARLVLCGKTWEKLEALHDALISVADPSVTFTPKLVL-LDISDINNMEAMGKEIQDCY 117

  Fly   128 HRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIA 192
            ..:|||:|||....:.....|.:|:|:::.:.:.|..:.|.:.::.:.:.:.  .|.|...::|.
 Frog   118 GCVDVLINNASMKMKGPLQSVSLELDKKIMDANYFGPITLVKAILPHMISRR--TGQIVLVNTIQ 180

  Fly   193 GFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGP 233
            |...|||...|.|:|||:..:...|:.|:.:.|||:....|
 Frog   181 GKIGVPFRAAYAASKHAIQGFFDCLRAEVEEFDVSVSTVSP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 49/190 (26%)
adh_short 47..245 CDD:278532 49/187 (26%)
dhrs7cXP_012826975.2 11beta-HSD1_like_SDR_c 35..257 CDD:187593 49/190 (26%)
LAP2alpha 425..629 CDD:371604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D429842at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.