DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31933 and CG9525

DIOPT Version :9

Sequence 1:NP_722734.1 Gene:CG31933 / 326176 FlyBaseID:FBgn0051933 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_609260.1 Gene:CG9525 / 34217 FlyBaseID:FBgn0032080 Length:678 Species:Drosophila melanogaster


Alignment Length:563 Identity:133/563 - (23%)
Similarity:211/563 - (37%) Gaps:136/563 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VPKGLRHMRVKCLNTFTNKTLHDDAHFFIQPPPEKLLKKPPATLKYWDGEKHSSGATSPISVMIL 212
            ||..:..||..|.|... :.|..|....:|||      |..|.|..|.        ..| :|:::
  Fly   163 VPPSVEGMRATCRNELA-EDLQSDTFVLVQPP------KTYAPLISWH--------RIP-NVLLI 211

  Fly   213 GLDSVSHLNLLRQMPRTVRYMRQNMSQVEFW----GFNKIGTNTYPNLIALLTGLS-------AA 266
            |.|.:|.:|..|..|...     |..:::.|    |:..||.||..||:|.|||.|       ..
  Fly   212 GFDGISQINFRRNFPLVF-----NQLKMQDWFRMDGYTGIGENTQSNLMASLTGYSPHTLMNLKC 271

  Fly   267 ESEAYWVRQKCMDNLPLIWKEFKRAGYNTSFAEDMAIYSMFYFGKPGFKRPTTDNNLHDFMVDLY 331
            :|...    .|:..:|||||.||:.|:.|::.|  .|.::|...|.|....|         :|.|
  Fly   272 DSSVI----GCLKTVPLIWKHFKKKGFITAYGE--GISNLFDSEKYGIFEGT---------IDFY 321

  Fly   332 I---NRQASSVSDTHCMGERAFMDILLEMNDRLL---PHTQRYPFFSFYWWANGF-HEFFNSPRL 389
            .   |.|:       |:..|..:....:..:..|   .:|.| |||..: :.||. :..:::.|:
  Fly   322 ARHKNLQS-------CIDRRFNIKHNYDYCEEFLKRHANTNR-PFFGVF-FGNGITNRSYDNARI 377

  Fly   390 ADGRFERLLRSLDDAGITNNTIIFFMSDHGLRWGLFRSSFQGMIEDSQPFLSVLYPKWMRLKYPM 454
            .....:: ::.....||...:|:...|.........:::|.   ::..|.|.:..|.|.:...|.
  Fly   378 QTELLDK-VKKFKKMGILTQSIVVLFSYPVSSVKEKKTNFS---QEDLPILYIWLPPWFKAFRPE 438

  Fly   455 AIKSLVGNAHSLVTTYDLHETLKHILEPSSLEDTSITQKTEELWKLKGSQTPRAV---------- 509
            .:::|..|:..|.:.||||.||:|:||                   .|.:.||||          
  Fly   439 IVQALRINSKRLTSPYDLHLTLQHLLE-------------------LGERWPRAVDKLVDCPTCQ 484

  Fly   510 SLFLPIPPWRNCNTSHIPSKFCLCHKQIPIPESNRVVTKSASI---IIDYVNQLMVE---YPVCI 568
            :||.|:|..|.|:.:.|....|.| ....:..||::  |..|:   |:..:|:.:..   :.:|.
  Fly   485 TLFAPVPENRTCSDAGIGESQCPC-DSYKLLSSNQM--KQLSVGKQIVRSINEFLNHHNLHELCH 546

  Fly   569 PLQLDSIESAYFAAPQRDDDFYIEKGHKNVYPEKGPFWKKQKYEDRDIVVRLKTKPGNAYFEGMT 633
            .|.|.|::...    ||.|...........|                    ....|.||.|....
  Fly   547 NLTLKSVKMVL----QRKDRKLSSGSTYRAY--------------------FSANPNNAEFSTTI 587

  Fly   634 RRQGSKLSLVGEVVRVGGEGNRNN-----DCIDNPLLEPFCHC 671
            |...::..|  |.:.|......||     .|:.......||.|
  Fly   588 RYANNRQEL--EYINVESINRLNNYQNDSSCMRRLRGRKFCIC 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31933NP_722734.1 DUF229 114..576 CDD:281053 115/461 (25%)
ALP_like 208..483 CDD:293745 75/292 (26%)
CG9525NP_609260.1 DUF229 66..554 CDD:281053 115/461 (25%)
ALP_like 206..466 CDD:293745 76/312 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466487
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JJT
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31599at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10974
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.