DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and YPS6

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_012305.3 Gene:YPS6 / 854857 SGDID:S000001478 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:431 Identity:94/431 - (21%)
Similarity:165/431 - (38%) Gaps:126/431 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KVPGSKVATLENL--------------YNTE-------YYTTLGFGNPPQDLKVLIDTGSANLWV 116
            |.|..|:|.:.|:              .||.       |...:..|.|||.|.:.:||||:::.|
Yeast    29 KFPVQKLADIINICTQDVSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTLYLQLDTGSSDMIV 93

  Fly   117 ------------------------------------LSSKCPDSVAPCANRIKYNSSASTTYRAI 145
                                                :||:..:::  |:....:::|.|:|:...
Yeast    94 NNADIAYCKSMSDGSDYASTDNYELTATFNGLPSTTISSEAYNTL--CSYWGTFDASNSSTFENN 156

  Fly   146 NTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFA 210
            .|.||..||..:     ..:|....|.|:|...::.:..|. ::|  :|.   ....||||:...
Yeast   157 ATFFNNTYGDGT-----YYAGTYGTDVVSFENITLNDFTFG-VSN--DTI---GNPSGILGISLP 210

  Fly   211 ----------SIAINSITPPFYN-----LMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSG 260
                      ::|:|. ||..|:     |..||.:|:..:|::|  ||.:| :.|.::.|..|..
Yeast   211 IAEFTDGIEYALALNR-TPFIYDNFPMELKNQGKINKIAYSLFL--NGPDA-HFGSILFGAVDKS 271

  Fly   261 LYSGCLTYVPVSSAGYWQFTMTSAN---------------------LNGFQFCENCEAILDVGTS 304
            .|:|.|..:|:..|    |....:|                     ::..||    ..:||.||:
Yeast   272 KYTGQLYTLPMLQA----FNTLGSNPGMIITAQSVAILDSESGNKTVSDIQF----PVMLDSGTT 328

  Fly   305 LIVVPEQVLDTINQILGVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLKS--SDYVLRYGN 367
            ...:|.::.:.|.:.......:...| ::.|||.:.   |.:.:|....|.:.:  |::|....:
Yeast   329 FSYLPTEIAEAIGKSFDGEYSSDDQG-YIFDCSKVN---DTLLSVDFGGFNISANISNFVTSAKD 389

  Fly   368 TCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            .||  .......|..:||:.||...|..||:....|.:|.|
Yeast   390 RCV--LNVKQSESTYMLGDAFLVDAYVVYDLENYEISIAQA 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 88/418 (21%)
Asp 89..408 CDD:278455 86/399 (22%)
YPS6NP_012305.3 SAP_like 65..428 CDD:133141 86/393 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341744
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.