DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and BAR1

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_012249.1 Gene:BAR1 / 854797 SGDID:S000001277 Length:587 Species:Saccharomyces cerevisiae


Alignment Length:383 Identity:107/383 - (27%)
Similarity:166/383 - (43%) Gaps:85/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCP------------------DSVAP-- 127
            |.:|   |.|||..|.|.|.|.||.|||||:.||:.|..|                  :.|.|  
Yeast    41 EEMY---YATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKPSI 102

  Fly   128 -CANRIKYNSSASTTYRAI-NTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIF--AEI 188
             |.:...||...|:||:.: |..|.|.|.    :|..| .|....:||:..|..|.|..|  |:.
Yeast   103 DCRSMSTYNEHRSSTYQYLENGRFYITYA----DGTFA-DGSWGTETVSINGIDIPNIQFGVAKY 162

  Fly   189 TNAPETAFLKSQLDGILGLGF---ASI-----AINSITPPFYNLM-AQGLVNRSVFSIYLNR--N 242
            ...|        :.|:||:||   .|:     |.|...|.|..:: ::.:::...:|::||.  :
Yeast   163 ATTP--------VSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLFLNSPDS 219

  Fly   243 GTNAINGGELILGGSDSGLYSGCLTYVPVSSA------GYWQFTMTSANLNGFQFCENCE----- 296
            ||     |.::.|..|...:||.|...|:.:.      ......||...| |.|...:||     
Yeast   220 GT-----GSIVFGAIDESKFSGDLFTFPMVNEYPTIVDAPATLAMTIQGL-GAQNKSSCEHETFT 278

  Fly   297 -----AILDVGTSLIVVPEQVLDTINQILGVLNPTAS--NGVFLVDCS-SIGDLPDIVFTVARRK 353
                 .:||.||||:..|:.:.|   ::...:|.:.|  .|::::||. |:||: :..|.....:
Yeast   279 TTKYPVLLDSGTSLLNAPKVIAD---KMASFVNASYSEEEGIYILDCPVSVGDV-EYNFDFGDLQ 339

  Fly   354 FPLKSSDYVL---RYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            ..:..|..:|   ..|:.|  ||.....|..::||::||.:.|..:|:....|.||.|
Yeast   340 ISVPLSSLILSPETEGSYC--GFAVQPTNDSMVLGDVFLSSAYVVFDLDNYKISLAQA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 104/379 (27%)
Asp 89..408 CDD:278455 104/375 (28%)
BAR1NP_012249.1 SAP_like 43..395 CDD:133141 105/379 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341743
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.