DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and YPS7

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_010636.1 Gene:YPS7 / 851950 SGDID:S000002757 Length:596 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:101/450 - (22%)
Similarity:156/450 - (34%) Gaps:145/450 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KAKTKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCA 129
            |:.|.:.|:.|...:|..:: ....||....||.|.|..::|:|.               :.|..
Yeast    32 KSGTSSSTEEPFPVLAVGKD-GRGNYYVNSTFGTPGQRQRLLVDI---------------IQPYI 80

  Fly   130 NRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQ----------------SQDTVNFAGY 178
            |.:...|.:...|..:... :.:|..|.....:.:|..|                ..|.:||...
Yeast    81 NLVSGTSESHNEYSGVYHK-HPSYLMNDSTSSVPVSPGQIYEISFIDGRAVNCTLVTDDMNFTNV 144

  Fly   179 SIKNQIFAEITNAPET----------------AFLKSQ-----LDGILGLGFASIAINSITPP-- 220
            |.:|...|.||:...|                :|...|     ..|:|||.      ..:|.|  
Yeast   145 SSENSSTALITDLMVTRDNVQFNSGSLSISNVSFFDIQSSNFKTSGLLGLS------GKVTNPGN 203

  Fly   221 ------------FYNLMAQG-LVNRSVFSIYLNRNGTN-------AINGGELILGGSDSGLYSGC 265
                        |.:|:... ::..|.:|::|..:.:.       ..|.|:|:|||.|..|::|.
Yeast   204 AIDSSQYTEQSYFLSLLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGT 268

  Fly   266 L------TYV-PVSSA---GYWQFTM----------TSANLNGFQFCENCEAILDVGTSLIVVPE 310
            |      .|| |||:|   ||....:          .|.|:....|..  .|:||..:|:..:| 
Yeast   269 LGKFDLIPYVDPVSNAVSVGYPIVPLGPIYIVSNSGQSLNMTSKDFLS--PALLDSTSSVSYLP- 330

  Fly   311 QVLDTINQILGVLNPTASNGV--FLVDCS------SIG-DLPDIVFTVARRKFPLKSSDY----- 361
              ..||.||...:..|....:  :||.||      |:| .|.::...:..|  .|.||.|     
Yeast   331 --TSTIIQIAVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLR--DLLSSTYDTSTN 391

  Fly   362 -------------VLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
                         :..|.||    .|.:|     ||||.|:...|...|:....|.:|.|
Yeast   392 SSMFFSSGQEACFLTLYANT----NTGVN-----ILGEAFIKNIYMAMDLEDNTIAIAQA 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 94/429 (22%)
Asp 89..408 CDD:278455 95/424 (22%)
YPS7NP_010636.1 pepsin_retropepsin_like 162..442 CDD:416259 70/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341742
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.