DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and YPS3

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:450 Identity:116/450 - (25%)
Similarity:178/450 - (39%) Gaps:105/450 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KLLLFWLTVLAVLAFEAEAR-----KRVRIGLHKNPEPIEENIKN-ELKTLSIKHNLNVDDTKAK 67
            ||.|..:..||||...|..|     |.|:|...|     ::|..| ||...|..|...|      
Yeast     2 KLQLAAVATLAVLTSPAFGRVLPDGKYVKIPFTK-----KKNGDNGELSKRSNGHEKFV------ 55

  Fly    68 TKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCP--DSVAPCAN 130
                       :|..::.|:.|    |..|.|.|:|.||:|||||:|||.....|  .||..|..
Yeast    56 -----------LANEQSFYSVE----LAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQ 105

  Fly   131 RIKYNSSASTTYRAINTA-FNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPET 194
            ...::.:.|:|::|..:: |..|||    :|..|...| .||.:.:....:....|| :.|...:
Yeast   106 YGVFDKTKSSTFKANKSSPFYAAYG----DGTYAEGAF-GQDKLKYNELDLSGLSFA-VANESNS 164

  Fly   195 AFLKSQLDGILGLGFASIAIN---------------SITPPFYNLMAQGLVNRSVFSIYLNRNGT 244
            .|      |:||:|.:::.:.               ...|.|  |...|.::.:.:|::||....
Yeast   165 TF------GVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLF--LKHSGAIDATAYSLFLNDESQ 221

  Fly   245 NAINGGELILGGSDSGLYSGCLTYVPV----SSAGYW-------------------QFTMTSANL 286
            ::   |.::.|..|...|.|.|..:|:    .|.||.                   ..|:|:..|
Yeast   222 SS---GSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKL 283

  Fly   287 NGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASN--GVFLVDCSSIGDLPDIVFTV 349
                     .|:||.||:|..:|.|.:..:.:   .||.:.|.  |.:...|.|..:...:.|..
Yeast   284 ---------PALLDSGTTLTYLPSQAVALLAK---SLNASYSKTLGYYEYTCPSSDNKTSVAFDF 336

  Fly   350 ARRKFPLKSSDYVLRYG-NTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            ...:.....||:.::.. .|||.......||:..|||:.||...|..||:....|.||.|
Yeast   337 GGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 92/367 (25%)
Asp 89..408 CDD:278455 93/362 (26%)
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 94/367 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341741
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.