DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G77480

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_850981.1 Gene:AT1G77480 / 844084 AraportID:AT1G77480 Length:466 Species:Arabidopsis thaliana


Alignment Length:403 Identity:92/403 - (22%)
Similarity:144/403 - (35%) Gaps:112/403 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DTKAKTKTDTKVPGSKVA--TLENLYNT-EYYTTLGFGNPPQDLKVLIDTGSANLWV-LSSKCPD 123
            |:.|:.|...:...|.|.  ...|:|.. .||..|..||||:...:.|||||...|| ..:.|..
plant    37 DSSAQVKLQNRRLSSTVVFPVSGNVYPLGYYYVLLNIGNPPKLFDLDIDTGSDLTWVQCDAPCNG 101

  Fly   124 SVAPCANRIKYNSSASTTYRAINTAFNIAYGSNSEEGPIALSGFQSQDTVNF-AGYS-------- 179
            ...|.|.:.|.|.:.......:.:..::     .::.|.|    ..:|..:: .|||        
plant   102 CTKPRAKQYKPNHNTLPCSHILCSGLDL-----PQDRPCA----DPEDQCDYEIGYSDHASSIGA 157

  Fly   180 -IKNQIFAEITNA-----------------------PETAFLKSQLDGILGLGFASIAINSITPP 220
             :.:::..::.|.                       |.||       ||||||...:.:::    
plant   158 LVTDEVPLKLANGSIMNLRLTFGCGYDQQNPGPHPPPPTA-------GILGLGRGKVGLST---- 211

  Fly   221 FYNLMAQGLVNRSVFSIYLNRNGTNAIN-GGELILGGSDSGL-YSGCLTYVPVSSAGYWQ----- 278
              .|.:.| :.::|....|:..|...:: |.||:   ..||: ::...|..|  |..|..     
plant   212 --QLKSLG-ITKNVIVHCLSHTGKGFLSIGDELV---PSSGVTWTSLATNSP--SKNYMAGPAEL 268

  Fly   279 -FTMTSANLNGFQFCENCEAILDVGTSLIV----VPEQVLDTINQILGVLNPTASNGVFLVDCSS 338
             |...:..:.|.      ..:.|.|:|...    ..:.:||.|.:.|        ||..|.|...
plant   269 LFNDKTTGVKGI------NVVFDSGSSYTYFNAEAYQAILDLIRKDL--------NGKPLTDTKD 319

  Fly   339 IGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGF-TSMNG-------NSLLIL---GEIFLGAY 392
            ...||    ...:.|.||||.|.|.:|..|....| ...||       .|.||:   |.:.||..
plant   320 DKSLP----VCWKGKKPLKSLDEVKKYFKTITLRFGNQKNGQLFQVPPESYLIITEKGRVCLGIL 380

  Fly   393 YTT------YDIV 399
            ..|      |:|:
plant   381 NGTEIGLEGYNII 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 87/382 (23%)
Asp 89..408 CDD:278455 85/374 (23%)
AT1G77480NP_850981.1 nucellin_like 65..419 CDD:133142 85/375 (23%)
Asp 66..413 CDD:278455 85/374 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.