DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G66180

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_564867.1 Gene:AT1G66180 / 842933 AraportID:AT1G66180 Length:430 Species:Arabidopsis thaliana


Alignment Length:380 Identity:77/380 - (20%)
Similarity:136/380 - (35%) Gaps:80/380 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYNSSASTTYRAINTA-- 148
            |:.....:|..|.|||..::::||||...|:   :|.....|...:..::.|.|:::..:..:  
plant    68 YSMALIISLPIGTPPQAQQMVLDTGSQLSWI---QCHRKKLPPKPKTSFDPSLSSSFSTLPCSHP 129

  Fly   149 --------FNIAYGSNSEEGPIALSGFQSQDTVNFA-GYSIKNQIFAEITNAPETAFL-----KS 199
                    |.:....:|.. ....|.|.:..|  || |..:|.:|....|.......|     .|
plant   130 LCKPRIPDFTLPTSCDSNR-LCHYSYFYADGT--FAEGNLVKEKITFSNTEITPPLILGCATESS 191

  Fly   200 QLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILG---GSDSGL 261
            ...||||:....:          :.::|..:::..:.|....|.......|...||   .|....
plant   192 DDRGILGMNRGRL----------SFVSQAKISKFSYCIPPKSNRPGFTPTGSFYLGDNPNSHGFK 246

  Fly   262 YSGCLTY---------------VPVSSAGYWQFTMTSANLNGFQFCENC----EAILDVGTSLIV 307
            |...||:               ||:...   :|.:...|::|..|..:.    :.::|.|:....
plant   247 YVSLLTFPESQRMPNLDPLAYTVPMIGI---RFGLKKLNISGSVFRPDAGGSGQTMVDSGSEFTH 308

  Fly   308 VPEQVLDTIN-QIL--------------GVLNPTASNGVFLVDCSSIGDLPDIVFTVARRKFPLK 357
            :.:...|.:. :|:              |..:......|.::. ..||||   ||...|....|.
plant   309 LVDAAYDKVRAEIMTRVGRRLKKGYVYGGTADMCFDGNVAMIP-RLIGDL---VFVFTRGVEILV 369

  Fly   358 SSDYVL---RYGNTCVS-GFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            ..:.||   ..|..||. |.:||.|.:..|:|.:.....:..:|:..:.:|.|.|
plant   370 PKERVLVNVGGGIHCVGIGRSSMLGAASNIIGNVHQQNLWVEFDVTNRRVGFAKA 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 75/376 (20%)
Asp 89..408 CDD:278455 75/375 (20%)
AT1G66180NP_564867.1 pepsin_A_like_plant 73..426 CDD:133143 76/375 (20%)
PTZ00165 <78..>124 CDD:240300 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.