DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G65240

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_176703.1 Gene:AT1G65240 / 842831 AraportID:AT1G65240 Length:475 Species:Arabidopsis thaliana


Alignment Length:381 Identity:82/381 - (21%)
Similarity:142/381 - (37%) Gaps:96/381 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIKYN-------SSASTTYR---- 143
            |:|.:..|:||::..|.:||||..||:....||    .|..:...|       .:||:|.:    
plant    74 YFTKIKLGSPPKEYHVQVDTGSDILWINCKPCP----KCPTKTNLNFRLSLFDMNASSTSKKVGC 134

  Fly   144 ----------------AINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAP 192
                            |:..:::|.|...|..     .|...:|.:..      .|:..::...|
plant   135 DDDFCSFISQSDSCQPALGCSYHIVYADESTS-----DGKFIRDMLTL------EQVTGDLKTGP 188

  Fly   193 ---ETAF------------LKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRN 242
               |..|            ..|.:||::|.|.::.::.|      .|.|.|...| |||..|:  
plant   189 LGQEVVFGCGSDQSGQLGNGDSAVDGVMGFGQSNTSVLS------QLAATGDAKR-VFSHCLD-- 244

  Fly   243 GTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGF------QFCENCEAILDV 301
              |...||...:|..||....   |...|.:..::...:...:::|.      ....|...|:|.
plant   245 --NVKGGGIFAVGVVDSPKVK---TTPMVPNQMHYNVMLMGMDVDGTSLDLPRSIVRNGGTIVDS 304

  Fly   302 GTSLIVVPEQVLDTINQILGVLNPTASNGVFLVD----CSSIGDLPDIVFTVARRKF--PLKSSD 360
            ||:|...|:.:.|::.:.:....|..   :.:|:    |.|.....|..|.....:|  .:|.:.
plant   305 GTTLAYFPKVLYDSLIETILARQPVK---LHIVEETFQCFSFSTNVDEAFPPVSFEFEDSVKLTV 366

  Fly   361 YVLRYGNT------C----VSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
            |...|..|      |    ..|.|:...:.:::||::.|......||:..::||.|
plant   367 YPHDYLFTLEEELYCFGWQAGGLTTDERSEVILLGDLVLSNKLVVYDLDNEVIGWA 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 81/379 (21%)
Asp 89..408 CDD:278455 82/381 (22%)
AT1G65240NP_176703.1 pepsin_A_like_plant 74..426 CDD:133143 82/381 (22%)
Asp 74..422 CDD:278455 81/379 (21%)
pepsin_retropepsin_like 74..>133 CDD:299705 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.