DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G31450

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_174430.1 Gene:AT1G31450 / 840035 AraportID:AT1G31450 Length:445 Species:Arabidopsis thaliana


Alignment Length:406 Identity:91/406 - (22%)
Similarity:141/406 - (34%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRI 132
            ||||.     :...:.|  ..||:.::..|.||..:..:.||||...||   :|    .||....
plant    70 TKTDL-----QSGLISN--GGEYFMSISIGTPPSKVFAIADTGSDLTWV---QC----KPCQQCY 120

  Fly   133 KYNS-----SASTTYRAIN----------------------TAFNIAYGSNS-EEGPIALSGFQS 169
            |.||     ..|:||:..:                      ..:..:||.|| .:|.:|.... |
plant   121 KQNSPLFDKKKSSTYKTESCDSKTCQALSEHEEGCDESKDICKYRYSYGDNSFTKGDVATETI-S 184

  Fly   170 QDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSV 234
            .|:.:.:..|....:|....|...|  .:....||:|||...:          :|::|  :..|:
plant   185 IDSSSGSSVSFPGTVFGCGYNNGGT--FEETGSGIIGLGGGPL----------SLVSQ--LGSSI 235

  Fly   235 ---FSIYLNR-----NGTNAINGGELILGGS---DSGLYSGCL--------------------TY 268
               ||..|:.     |||:.||.|...:..:   ||...:..|                    |.
plant   236 GKKFSYCLSHTAATTNGTSVINLGTNSIPSNPSKDSATLTTPLIQKDPETYYFLTLEAVTVGKTK 300

  Fly   269 VPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTI-----NQILGVLNPTAS 328
            :|.:..||        .|||.........|:|.||:|.::.....|..     ..:.|....:..
plant   301 LPYTGGGY--------GLNGKSSKRTGNIIIDSGTTLTLLDSGFYDDFGTAVEESVTGAKRVSDP 357

  Fly   329 NGVFLVDCSSIGD----LPDIV--FTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEI 387
            .|: |..|...||    ||.|.  ||.|..|....::...|.....|:|...:   ..:.|.|.:
plant   358 QGL-LTHCFKSGDKEIGLPAITMHFTNADVKLSPINAFVKLNEDTVCLSMIPT---TEVAIYGNM 418

  Fly   388 FLGAYYTTYDIVYKLI 403
            ....:...||:..|.:
plant   419 VQMDFLVGYDLETKTV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 87/392 (22%)
Asp 89..408 CDD:278455 86/385 (22%)
AT1G31450NP_174430.1 PLN03146 8..444 CDD:178691 91/406 (22%)
pepsin_A_like_plant 84..441 CDD:133143 86/385 (22%)
pepsin_retropepsin_like 89..>141 CDD:299705 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.