DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G25510

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_173922.1 Gene:AT1G25510 / 839137 AraportID:AT1G25510 Length:483 Species:Arabidopsis thaliana


Alignment Length:448 Identity:89/448 - (19%)
Similarity:175/448 - (39%) Gaps:140/448 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NELKTLSIKHNLNVDDTKAK---TKTDTKVPGSKVATLE---NLYNT------------------ 88
            ::.|:|::. .||.|..:.|   |:.|..:.....|.|:   .:|.|                  
plant    83 SDYKSLTLA-RLNRDTARVKSLITRLDLAINNISKADLKPISTMYTTEEQDIEAPLISGTTQGSG 146

  Fly    89 EYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRIK--YNSSASTTY--------- 142
            ||:|.:|.|.|.:::.:::||||...|:..:.|.|    |.::.:  :..|:|::|         
plant   147 EYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPCAD----CYHQTEPIFEPSSSSSYEPLSCDTPQ 207

  Fly   143 ---------RAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLK 198
                     |.....:.::||    :|...:..| :.:|:......::| :.....::.|..|:.
plant   208 CNALEVSECRNATCLYEVSYG----DGSYTVGDF-ATETLTIGSTLVQN-VAVGCGHSNEGLFVG 266

  Fly   199 SQLDGILGLGFASIAI---------------------------NSITPPFYNLMAQGLVNRSVFS 236
            :.  |:||||...:|:                           .|::|.  .::|..|.|..:.:
plant   267 AA--GLLGLGGGLLALPSQLNTTSFSYCLVDRDSDSASTVDFGTSLSPD--AVVAPLLRNHQLDT 327

  Fly   237 I-YLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILD 300
            . ||...|.:.  ||||:              .:|.||     |.|..:...|.        |:|
plant   328 FYYLGLTGISV--GGELL--------------QIPQSS-----FEMDESGSGGI--------IID 363

  Fly   301 VGTSLIVVPEQVLDTINQ--ILGVLNPTASNGVFLVD-CSSIG-----DLPDIVFTVARRKFP-- 355
            .||::..:..::.:::..  :.|.|:...:.||.:.| |.::.     ::|.:.|     .||  
plant   364 SGTAVTRLQTEIYNSLRDSFVKGTLDLEKAAGVAMFDTCYNLSAKTTVEVPTVAF-----HFPGG 423

  Fly   356 ----LKSSDYVL---RYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
                |.:.:|::   ..|..|::  .:...:||.|:|.:.......|:|:...|||.:
plant   424 KMLALPAKNYMIPVDSVGTFCLA--FAPTASSLAIIGNVQQQGTRVTFDLANSLIGFS 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 80/409 (20%)
Asp 89..408 CDD:278455 77/383 (20%)
AT1G25510NP_173922.1 pepsin_retropepsin_like 147..483 CDD:299705 77/383 (20%)
Asp 147..478 CDD:278455 76/380 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.