DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G09750

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_563851.1 Gene:AT1G09750 / 837504 AraportID:AT1G09750 Length:449 Species:Arabidopsis thaliana


Alignment Length:388 Identity:90/388 - (23%)
Similarity:149/388 - (38%) Gaps:83/388 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCAN-RIKYN 135
            |.||   ||:...|:...|......|.|||.:.:::||.:..:|:..|.|    :.|:| ...:|
plant    89 TSVP---VASGNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGC----SGCSNASTSFN 146

  Fly   136 SSASTTYRAIN-----------------------TAFNIAYGSNSEEGPIALSGFQSQDTVNFAG 177
            :::|:||..::                       .:||.:||.:|     :.|....|||:..|.
plant   147 TNSSSTYSTVSCSTAQCTQARGLTCPSSSPQPSVCSFNQSYGGDS-----SFSASLVQDTLTLAP 206

  Fly   178 YSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNRN 242
            ..|.|..|..|.:|...: |..|  |::|||...:::.|.|...|:         .||| |...:
plant   207 DVIPNFSFGCINSASGNS-LPPQ--GLMGLGRGPMSLVSQTTSLYS---------GVFS-YCLPS 258

  Fly   243 GTNAINGGEL---ILGGSDSGLYSGCLT--------YVPVS--SAGYWQFTMTSANLNGFQFCEN 294
            ..:....|.|   :||...|..|:..|.        ||.::  |.|..|..:....|. |.....
plant   259 FRSFYFSGSLKLGLLGQPKSIRYTPLLRNPRRPSLYYVNLTGVSVGSVQVPVDPVYLT-FDANSG 322

  Fly   295 CEAILDVGTSLIVVPEQVLDTIN------------QILGVLNPTASNGVFLVDCSSIGDLPDIVF 347
            ...|:|.||.:....:.|.:.|.            ..||     |.:..|..|..::.....:..
plant   323 AGTIIDSGTVITRFAQPVYEAIRDEFRKQVNVSSFSTLG-----AFDTCFSADNENVAPKITLHM 382

  Fly   348 TVARRKFPLKSSDYVLRYGN-TCVS-GFTSMNGNSLL-ILGEIFLGAYYTTYDIVYKLIGLAP 407
            |....|.|::::......|. ||:| .....|.|::| ::..:........:|:....||:||
plant   383 TSLDLKLPMENTLIHSSAGTLTCLSMAGIRQNANAVLNVIANLQQQNLRILFDVPNSRIGIAP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 83/375 (22%)
Asp 89..408 CDD:278455 84/371 (23%)
AT1G09750NP_563851.1 pepsin_retropepsin_like 103..448 CDD:416259 84/371 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.