DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT1G08210

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001320253.1 Gene:AT1G08210 / 837342 AraportID:AT1G08210 Length:540 Species:Arabidopsis thaliana


Alignment Length:387 Identity:96/387 - (24%)
Similarity:153/387 - (39%) Gaps:104/387 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKC----------------------PDSVAPCANRI 132
            |||.:..|.||::..|.|||||..|||..:.|                      ..|:..|::|.
plant   132 YYTKVKLGTPPREFNVQIDTGSDVLWVSCTSCNGCPKTSELQIQLSFFDPGVSSSASLVSCSDRR 196

  Fly   133 KYNSSASTTYRAINT--AFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAP--- 192
            .|::..:.:..:.|.  :::..||..|......:|.|.|.|||..:..:|.       ::||   
plant   197 CYSNFQTESGCSPNNLCSYSFKYGDGSGTSGYYISDFMSFDTVITSTLAIN-------SSAPFVF 254

  Fly   193 -----ETAFL---KSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYL--NRNGTNAI 247
                 ::..|   :..:|||.|||..|:::.|      .|..|||..| |||..|  :::|    
plant   255 GCSNLQSGDLQRPRRAVDGIFGLGQGSLSVIS------QLAVQGLAPR-VFSHCLKGDKSG---- 308

  Fly   248 NGGELILG---GSDSGLYSGCLTYVP-VSSAGYWQFTMTSANLNG---------FQFCENCEAIL 299
             ||.::||   ..|:       .|.| |.|..::...:.|..:||         |........|:
plant   309 -GGIMVLGQIKRPDT-------VYTPLVPSQPHYNVNLQSIAVNGQILPIDPSVFTIATGDGTII 365

  Fly   300 DVGTSLIVVPEQVLDTINQILGVLNPTASNG---------VFLVDCSSIGDLPDIVFTVA----- 350
            |.||:|..:|::.....  |..|.|..:..|         .|.:....:...|.:..:.|     
plant   366 DTGTTLAYLPDEAYSPF--IQAVANAVSQYGRPITYESYQCFEITAGDVDVFPQVSLSFAGGASM 428

  Fly   351 ----RRKFPLKSSDYVLRYGNT--CVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLA 406
                |....:.||.     |::  |: ||..|:...:.|||::.|......||:|.:.||.|
plant   429 VLGPRAYLQIFSSS-----GSSIWCI-GFQRMSHRRITILGDLVLKDKVVVYDLVRQRIGWA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 95/385 (25%)
Asp 89..408 CDD:278455 96/387 (25%)
AT1G08210NP_001320253.1 pepsin_A_like_plant 132..488 CDD:133143 96/387 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.