DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT5G37540

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_568551.1 Gene:AT5G37540 / 833732 AraportID:AT5G37540 Length:442 Species:Arabidopsis thaliana


Alignment Length:426 Identity:80/426 - (18%)
Similarity:147/426 - (34%) Gaps:123/426 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TKAKTKTDTKVPGSKVATLENL-YNTEYYTTLGFGNPPQDLKVLIDTGSANLWV----------- 116
            |...::.:...|.|......|: |:.....:|..|.|.|..::::||||...|:           
plant    53 TSLLSRRNPSPPSSPYTFRSNIKYSMALILSLPIGTPSQSQELVLDTGSQLSWIQCHPKKIKKPL 117

  Fly   117 ----------LSS--------------KCPDSVAP--C-ANRIKYNS--SASTTYRAINTAFNIA 152
                      |||              :.||...|  | :||:.:.|  .|..|:...|......
plant   118 PPPTTSFDPSLSSSFSDLPCSHPLCKPRIPDFTLPTSCDSNRLCHYSYFYADGTFAEGNLVKEKF 182

  Fly   153 YGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSI 217
            ..|||:..|..:.|...:.|                           ...||||:....:     
plant   183 TFSNSQTTPPLILGCAKEST---------------------------DEKGILGMNLGRL----- 215

  Fly   218 TPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSG---LYSGCLTY----------- 268
                 :.::|..:::..:.|....|.....:.|...||.:.:.   .|...||:           
plant   216 -----SFISQAKISKFSYCIPTRSNRPGLASTGSFYLGDNPNSRGFKYVSLLTFPQSQRMPNLDP 275

  Fly   269 ----VPVSSAGYWQFTMTSANLNGFQFCENC----EAILDVG---TSLI-VVPEQVLDTINQILG 321
                ||:......|..:   |:.|..|..:.    :.::|.|   |.|: |..::|.:.|.:::|
plant   276 LAYTVPLQGIRIGQKRL---NIPGSVFRPDAGGSGQTMVDSGSEFTHLVDVAYDKVKEEIVRLVG 337

  Fly   322 -------VLNPTAS---NGVFLVDCSSIGDLPDIVFTVARR-KFPLKSSDYVLRYGN--TCVS-G 372
                   |...||.   :|...::...:  :.|:||...|. :..::....::..|.  .||. |
plant   338 SRLKKGYVYGSTADMCFDGNHSMEIGRL--IGDLVFEFGRGVEILVEKQSLLVNVGGGIHCVGIG 400

  Fly   373 FTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAPA 408
            .:||.|.:..|:|.:.....:..:|:..:.:|.:.|
plant   401 RSSMLGAASNIIGNVHQQNLWVEFDVTNRRVGFSKA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 76/404 (19%)
Asp 89..408 CDD:278455 74/398 (19%)
AT5G37540NP_568551.1 pepsin_A_like_plant 76..438 CDD:133143 76/403 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.