DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT5G36260

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_198475.2 Gene:AT5G36260 / 833623 AraportID:AT5G36260 Length:482 Species:Arabidopsis thaliana


Alignment Length:396 Identity:96/396 - (24%)
Similarity:147/396 - (37%) Gaps:123/396 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCP------DSVAPCANRIKYNSSASTTYRAIN-- 146
            |:|.:..|:||::..|.:||||..|||..:.||      |...|.:   .|:|..|:|.:.:.  
plant    78 YFTKIKLGSPPKEYYVQVDTGSDILWVNCAPCPKCPVKTDLGIPLS---LYDSKTSSTSKNVGCE 139

  Fly   147 ------------------TAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAP- 192
                              .::::.||..|..     .|...:|.:..      .|:...:..|| 
plant   140 DDFCSFIMQSETCGAKKPCSYHVVYGDGSTS-----DGDFIKDNITL------EQVTGNLRTAPL 193

  Fly   193 --ETAF------------LKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYL-NRN 242
              |..|            ..|.:|||:|.|.::.:|.|      .|.|.|...| :||..| |.|
plant   194 AQEVVFGCGKNQSGQLGQTDSAVDGIMGFGQSNTSIIS------QLAAGGSTKR-IFSHCLDNMN 251

  Fly   243 GTNAINGGE-------------------LILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNG 288
            |......||                   :||.|.|   ..|....:|.|        :.|.|.:|
plant   252 GGGIFAVGEVESPVVKTTPIVPNQVHYNVILKGMD---VDGDPIDLPPS--------LASTNGDG 305

  Fly   289 FQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFL------VDCSSIGDLPDIVF 347
                   ..|:|.||:|..:|:.:.:::.:.:     ||...|.|      ..|.|.....|..|
plant   306 -------GTIIDSGTTLAYLPQNLYNSLIEKI-----TAKQQVKLHMVQETFACFSFTSNTDKAF 358

  Fly   348 TVARRKF--PLKSS----DYV--LRYGNTCV----SGFTSMNGNSLLILGEIFLGAYYTTYDIVY 400
            .|....|  .||.|    ||:  ||....|.    .|.|:.:|..:::||::.|......||:..
plant   359 PVVNLHFEDSLKLSVYPHDYLFSLREDMYCFGWQSGGMTTQDGADVILLGDLVLSNKLVVYDLEN 423

  Fly   401 KLIGLA 406
            ::||.|
plant   424 EVIGWA 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 95/394 (24%)
Asp 89..408 CDD:278455 96/396 (24%)
AT5G36260NP_198475.2 pepsin_A_like_plant 78..433 CDD:133143 96/396 (24%)
pepsin_retropepsin_like 78..>139 CDD:416259 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.