DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and PCS1

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_195839.1 Gene:PCS1 / 831845 AraportID:AT5G02190 Length:453 Species:Arabidopsis thaliana


Alignment Length:434 Identity:89/434 - (20%)
Similarity:153/434 - (35%) Gaps:143/434 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 TKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCANRI 132
            |.||.: |..|   |...:|.....||..|.|||::.::|||||...|:   :|..|..|  |.:
plant    55 TPTDHR-PTDK---LHFHHNVTLTVTLTVGTPPQNISMVIDTGSELSWL---RCNRSSNP--NPV 110

  Fly   133 -KYNSSASTTYRAINTA------------------------FNIAYG-SNSEEGPIALSGFQSQD 171
             .::.:.|::|..|..:                        ..::|. ::|.||.:|...|...:
plant   111 NNFDPTRSSSYSPIPCSSPTCRTRTRDFLIPASCDSDKLCHATLSYADASSSEGNLAAEIFHFGN 175

  Fly   172 TVNFAGYSIKNQIFAEITNA----PETAFLKSQLDGILGLGFASIA-INSITPPFYNLMAQGLVN 231
            :.|.:     |.||..:.:.    ||.   .::..|:||:...|:: |:.:..|.::...     
plant   176 STNDS-----NLIFGCMGSVSGSDPEE---DTKTTGLLGMNRGSLSFISQMGFPKFSYCI----- 227

  Fly   232 RSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPV----SSAGYWQFTMTSANLNGFQFC 292
                      :||:...|  .:|.|..:..:...|.|.|:    :...|:.....:..|.|    
plant   228 ----------SGTDDFPG--FLLLGDSNFTWLTPLNYTPLIRISTPLPYFDRVAYTVQLTG---- 276

  Fly   293 ENCEAILDVGTSLIVVPEQVL------------DTINQILGVLNP--TA--------SNGVFLVD 335
                  :.|...|:.:|:.||            |:..|...:|.|  ||        :||:.   
plant   277 ------IKVNGKLLPIPKSVLVPDHTGAGQTMVDSGTQFTFLLGPVYTALRSHFLNRTNGIL--- 332

  Fly   336 CSSIGDLPDIVF----TVARRKFPLKSSDYVLR-----------------------------YGN 367
              ::.:.||.||    .:..|..|::....:|.                             .||
plant   333 --TVYEDPDFVFQGTMDLCYRISPVRIRSGILHRLPTVSLVFEGAEIAVSGQPLLYRVPHLTVGN 395

  Fly   368 TCVSGFTSMN----GNSLLILGEIFLGAYYTTYDIVYKLIGLAP 407
            ..|..||..|    |....::|.......:..:|:....|||||
plant   396 DSVYCFTFGNSDLMGMEAYVIGHHHQQNMWIEFDLQRSRIGLAP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 81/417 (19%)
Asp 89..408 CDD:278455 82/413 (20%)
PCS1NP_195839.1 pepsin_A_like_plant 82..442 CDD:133143 79/403 (20%)
Asp 82..440 CDD:278455 79/403 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.