DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT5G07030

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_196320.2 Gene:AT5G07030 / 830594 AraportID:AT5G07030 Length:455 Species:Arabidopsis thaliana


Alignment Length:424 Identity:87/424 - (20%)
Similarity:147/424 - (34%) Gaps:116/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WNHFKLLLFWLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKH------------ 57
            :|....|:.:|.:.::|.        :.:||: :|.......:::..||.|.|            
plant    14 YNTMSTLVLFLQLFSILP--------LALGLN-HPNCDLTKTQDQGSTLRIFHIDSPCSPFKSSS 69

  Fly    58 ----NLNVDDTKAKTKT-----DTKVPGSKVATL----ENLYNTEYYTTLGFGNPPQDLKVLIDT 109
                ...|..|.|:.:.     .:.|.|..|..:    :.|.:|.|......|.|.|.|.:.:||
plant    70 PLSWEARVLQTLAQDQARLQYLSSLVAGRSVVPIASGRQMLQSTTYIVKALIGTPAQPLLLAMDT 134

  Fly   110 GSANLWVLSSKCPDSVAPCANRIKYNSSASTTYRAIN------------------TAFNIAYGSN 156
            .|...|:..|.|    ..|.:...::.:.||:::.::                  .:||:.|||:
plant   135 SSDVAWIPCSGC----VGCPSNTAFSPAKSTSFKNVSCSAPQCKQVPNPTCGARACSFNLTYGSS 195

  Fly   157 SEEGPIALSGFQSQDTVNFAGYSIK-------NQIFAEITNAPETAFLKSQLDGILGLGFASIAI 214
            |      ::...||||:..|...||       |::....|..|.        .|:||||...:::
plant   196 S------IAANLSQDTIRLAADPIKAFTFGCVNKVAGGGTIPPP--------QGLLGLGRGPLSL 246

  Fly   215 NSITPPFYNLMAQGLVNRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQF 279
            .|.....|         :|.||               ..|....|..:||.|...|.|.....::
plant   247 MSQAQSIY---------KSTFS---------------YCLPSFRSLTFSGSLRLGPTSQPQRVKY 287

  Fly   280 TMTSAN-LNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFLVDCSSIGDLP 343
            |....| .....:..|..|| .||..::.:|...:        ..||:...|......:....|.
plant   288 TQLLRNPRRSSLYYVNLVAI-RVGRKVVDLPPAAI--------AFNPSTGAGTIFDSGTVYTRLA 343

  Fly   344 DIVFTVARRKFPLK---SSDYVLRYG--NTCVSG 372
            ..|:...|.:|..:   ::..|...|  :||.||
plant   344 KPVYEAVRNEFRKRVKPTTAVVTSLGGFDTCYSG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 70/326 (21%)
Asp 89..408 CDD:278455 68/315 (22%)
AT5G07030NP_196320.2 PLN03146 18..419 CDD:178691 86/420 (20%)
pepsin_retropepsin_like 115..454 CDD:299705 68/314 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.