DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT4G33490

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_001190905.1 Gene:AT4G33490 / 829486 AraportID:AT4G33490 Length:425 Species:Arabidopsis thaliana


Alignment Length:402 Identity:80/402 - (19%)
Similarity:133/402 - (33%) Gaps:124/402 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NLYNTEYY-TTLGFGNPPQDLKVLIDTGSANLWVLSS----KCPDSVAP---------------- 127
            |:|...|| .|:..|.||:...:.:||||...|:...    :|.::..|                
plant    53 NVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQPSSDLIPCNDPLC 117

  Fly   128 ----------------CANRIKYNSSASTTYRAINTAFNIAYGSNSEEGP-IALSGFQSQDTVNF 175
                            |...::|....|:....:...|::.|.......| :||.          
plant   118 KALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFSMNYTQGLRLTPRLALG---------- 172

  Fly   176 AGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLVNRSVFSIYLN 240
            .||   :||....::.|        |||:||||...::|.|      .|.:||.| ::|....|:
plant   173 CGY---DQIPGASSHHP--------LDGVLGLGRGKVSILS------QLHSQGYV-KNVIGHCLS 219

  Fly   241 RNGTNAI----------------------------NGGELILGGSDSGL------YSGCLTYVPV 271
            ..|...:                            .||||:.||..:||      :....:|...
plant   220 SLGGGILFFGDDLYDSSRVSWTPMSREYSKHYSPAMGGELLFGGRTTGLKNLLTVFDSGSSYTYF 284

  Fly   272 SSAGYWQFT-MTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVFLVD 335
            :|..|...| :....|:|...   .||..|....|.....:...:|.::.....|.|.:......
plant   285 NSKAYQAVTYLLKRELSGKPL---KEARDDHTLPLCWQGRRPFMSIEEVKKYFKPLALSFKTGWR 346

  Fly   336 CSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNG-----NSLLILGEIFLGAYYTT 395
            ..::.::|...:.:...|            ||.|:.   .:||     .:|.::|:|.:......
plant   347 SKTLFEIPPEAYLIISMK------------GNVCLG---ILNGTEIGLQNLNLIGDISMQDQMII 396

  Fly   396 YDIVYKLIGLAP 407
            ||...:.||..|
plant   397 YDNEKQSIGWMP 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 79/399 (20%)
Asp 89..408 CDD:278455 78/397 (20%)
AT4G33490NP_001190905.1 nucellin_like 58..411 CDD:133142 78/397 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.