DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT4G30030

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_194732.1 Gene:AT4G30030 / 829126 AraportID:AT4G30030 Length:424 Species:Arabidopsis thaliana


Alignment Length:325 Identity:68/325 - (20%)
Similarity:114/325 - (35%) Gaps:108/325 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 KAKTKTDTKV----------PGSKVATLENLYNTEYYT----------TLGFGNPPQDLKVLIDT 109
            :.||:..:|:          |.|:   |:||:...:.|          .:..||||....:||||
plant    36 RTKTQESSKIKIGYLHSKSTPASR---LDNLWTVSHVTPIPNPAAFLANISIGNPPVPQLLLIDT 97

  Fly   110 GSANLWV--LSSKCPDSVAPCANRIKYNSSASTTYRAI-------------------NTAFNIAY 153
            ||...|:  |..||.....|.     ::.|.|:|||..                   |..:::.|
plant    98 GSDLTWIHCLPCKCYPQTIPF-----FHPSRSSTYRNASCVSAPHAMPQIFRDEKTGNCQYHLRY 157

  Fly   154 GSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAI---- 214
            ...|....|......:.:|.:....|.:|.:|.  .....:.|.|  ..|:||||..:.:|    
plant   158 RDFSNTRGILAEEKLTFETSDDGLISKQNIVFG--CGQDNSGFTK--YSGVLGLGPGTFSIVTRN 218

  Fly   215 ---------NSITPPFY--NLMAQGLVNR--------SVFS--IYLNRNGTNAINGGELILGGSD 258
                     .|:|.|.|  |::..|...:        .:|.  .||:   ..||:.||.:|    
plant   219 FGSKFSYCFGSLTNPTYPHNILILGNGAKIEGDPTPLQIFQDRYYLD---LQAISFGEKLL---- 276

  Fly   259 SGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENCEAILDVGTSLIVVPEQVLDTINQILGVL 323
             .:..|  |:....|.|                    ..::|.|.|..::..:..:|:::.:..|
plant   277 -DIEPG--TFQRYRSQG--------------------GTVIDTGCSPTILAREAYETLSEEIDFL 318

  Fly   324  323
            plant   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 63/298 (21%)
Asp 89..408 CDD:278455 60/291 (21%)
AT4G30030NP_194732.1 pepsin_A_like_plant 77..419 CDD:133143 59/281 (21%)
Asp 77..414 CDD:278455 59/281 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.