DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and AT4G22050

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_193936.2 Gene:AT4G22050 / 828294 AraportID:AT4G22050 Length:354 Species:Arabidopsis thaliana


Alignment Length:390 Identity:124/390 - (31%)
Similarity:187/390 - (47%) Gaps:59/390 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLTVLAVLAFEAEARKRVRIGLHKNPEPIEENIKNELKTLSIKHNLNVDDTKAKTKTDTKVPGSK 78
            :.::..:.:|.:.:...|||                  .|.|.|.|:.::...:           
plant     2 YTSIFFIFSFLSVSEALVRI------------------PLQIDHALSTNNDGVQ----------- 37

  Fly    79 VATLENLYNTEYYTTLGFGNPPQDLKVLIDTGSANLWVLSSKCPDSVAPCAN-RIKYNSSASTTY 142
               |:|:.:..||..:..|||.|...||.||||::|||.|.   :.:|...| |.:|.||||.|:
plant    38 ---LKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSLWVPSE---NWLAKTENPRNRYISSASRTF 96

  Fly   143 RAINTAFNIAYGSNSEEGPIALSGFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQ-LDGILG 206
            :...|...:.||..|      |:||.|.|||...|.||.:|.|.|....|...|.|.. .|||||
plant    97 KENGTKAELKYGKGS------LTGFLSVDTVTVGGISITSQTFIEGVKTPYKEFFKKMPFDGILG 155

  Fly   207 LGFASIAINSITPPFYNLMAQGLVNRSVFSIYLNR-NGTNAINGGELILGGSDSGLYSGCLTYVP 270
            |.|.. .:|..|..:::::.||.:.::||||:|.| :.:..|||||::.||.....:||..|||.
plant   156 LRFTD-PLNFGTSVWHSMVFQGKIAKNVFSIWLRRFSNSGEINGGEVVFGGIIPAHFSGDHTYVD 219

  Fly   271 VSSAGYWQFTMTSANLNG--FQFCEN-CEAILDVGTSLIVVPEQVLDTINQILGVLNPTASNGVF 332
            |...|.: |.|::..:.|  ...|.: |:||:|.|:|.|.||....|.|::.:|| .|       
plant   220 VEGPGNF-FAMSNIWVGGKNTNICSSGCKAIVDSGSSNINVPMDSADEIHRYIGV-EP------- 275

  Fly   333 LVDCSSIGDLPDIVFTVARRKFPLKSSDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYD 397
              :|::...|||:.||:..:.|.|...||:.|..:.|.|.|......|...||..|:..::|.:|
plant   276 --NCNNFETLPDVTFTIGGKAFVLTPLDYIRRSRSQCTSKFVGKTNRSHWTLGIPFMRVFHTVFD 338

  Fly   398  397
            plant   339  338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 116/322 (36%)
Asp 89..408 CDD:278455 114/315 (36%)
AT4G22050NP_193936.2 pepsin_retropepsin_like 36..351 CDD:386101 116/338 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.