DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31926 and UND

DIOPT Version :9

Sequence 1:NP_001259870.1 Gene:CG31926 / 326174 FlyBaseID:FBgn0051926 Length:410 Species:Drosophila melanogaster
Sequence 2:NP_193028.1 Gene:UND / 826904 AraportID:AT4G12920 Length:389 Species:Arabidopsis thaliana


Alignment Length:383 Identity:79/383 - (20%)
Similarity:124/383 - (32%) Gaps:116/383 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PIEENIKNELKTLSIK--HNLNVDDTKAKTKTDTKVPGSKVATLENLYNTEYYTTLGFGNPPQDL 103
            |:..|.|.:..||.|.  ||       .....|:||....:::..:.....:...:.||:|.:..
plant    14 PLLINAKPKRVTLHIPLVHN-------GANFYDSKVVSLPLSSPHSQRGLAFMAEIHFGSPQKKQ 71

  Fly   104 KVLIDTGSANLWVLSSKCPDSVAPC-ANRI--KYNSSASTTYRAINTAFNIAYGSNSEEGPIALS 165
            .:.:||||:..|.....|.|    | |.:|  ||..:||.|||..     :...|:.:..|    
plant    72 FLHMDTGSSLTWTQCFPCSD----CYAQKIYPKYRPAASITYRDA-----MCEDSHPKSNP---- 123

  Fly   166 GFQSQDTVNFAGYSIKNQIFAEITNAPETAFLKSQLDGILGLGFASIAINSITPPFYNLMAQGLV 230
            .|..........|   .|.:.:.||...|            |....|.:::....|         
plant   124 HFAFDPLTRICTY---QQHYLDETNIKGT------------LAQEMITVDTHDGGF--------- 164

  Fly   231 NRSVFSIYLNRNGTNAINGGELILGGSDSGLYSGCLTYVPVSSAGYWQFTMTSANLNGFQFCENC 295
             :.|..:|.   |.|.::.|....|....||             |..::::.....:.|.||   
plant   165 -KRVHGVYF---GCNTLSDGSYFTGTGILGL-------------GVGKYSIIGEFGSKFSFC--- 209

  Fly   296 EAILDVGTSLIVVPEQVLDTINQILG-VLNPTASNGVFLVDCSSIGDLPDIV-FTVARRKFPLKS 358
                                    || :..|.||:.:.|.|.:::...|.:: .|.....|.|:|
plant   210 ------------------------LGEISEPKASHNLILGDGANVQGHPTVINITEGHTIFQLES 250

  Fly   359 ---------SDYVLRYGNTCVSGFTSMNGNSLLILGEIFLGAYYTTYDIVYKLIGLAP 407
                     .|.|..:.:|   |.|         |..:....||...|....|||..|
plant   251 IIVGEEITLDDPVQVFVDT---GST---------LSHLSTNLYYKFVDAFDDLIGSRP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31926NP_001259870.1 pepsin_retropepsin_like 82..406 CDD:299705 67/337 (20%)
Asp 89..408 CDD:278455 68/333 (20%)
UNDNP_193028.1 pepsin_A_like_plant 57..387 CDD:133143 68/333 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D753343at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.